BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0833 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 29 0.050 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.5 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 4.4 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 4.4 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 28.7 bits (61), Expect = 0.050 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 555 SSNAFRFEGRGSRCNYTETLELISQGGWRI 466 + N+ ++ G Y E +EL +GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 549 NAFRFEGRGSRCNYTETLELISQGGW 472 +A R+ G Y E +E + GGW Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGW 315 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 274 KLRYYVLQFSINNVLKY 224 K+R+ +L INN+++Y Sbjct: 465 KIRFVILNKQINNLIEY 481 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 274 KLRYYVLQFSINNVLKY 224 K+R+ +L INN+++Y Sbjct: 190 KIRFVILNKQINNLIEY 206 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,839 Number of Sequences: 336 Number of extensions: 3957 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -