BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0833 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ... 27 2.0 SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|... 27 3.6 SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|ch... 26 6.2 SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr... 25 8.2 SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 25 8.2 >SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces pombe|chr 3|||Manual Length = 571 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 365 SMYFLYFLLLRWVDKITGHL 424 ++YF Y L+ R +DK+ GHL Sbjct: 304 NLYFAYALMQRAIDKLYGHL 323 >SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|chr 1|||Manual Length = 512 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -2 Query: 705 EICYSNYCSLRTLNILKRCSCKSEGLFYLLLVALMSPHG 589 +I YS YC+ ++ +R + +GL + + PHG Sbjct: 288 KISYSLYCNETLVSFFRRPAFSPDGLLLVTPAGRLRPHG 326 >SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 25.8 bits (54), Expect = 6.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 396 LSNKKYKKYMLSSAIRPVLFSIKFF 322 L +KK+KKY + A R V + FF Sbjct: 264 LGSKKFKKYQILEACRDVRMYLYFF 288 >SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1225 Score = 25.4 bits (53), Expect = 8.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 63 FEFDFVKLGF*ALFILITVC 4 F F +++ GF +LFI++ VC Sbjct: 167 FLFGYLRFGFLSLFIIMAVC 186 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 25.4 bits (53), Expect = 8.2 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 536 NRNALLLHGRNRQGGGTYPCGLIRATNS 619 N ++LHG N Q CGL T+S Sbjct: 106 NGELIVLHGINHQAAMLTACGLFMVTSS 133 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,916,467 Number of Sequences: 5004 Number of extensions: 60313 Number of successful extensions: 128 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -