BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0832 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 26 1.1 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 25 1.9 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 1.9 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.9 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 25 1.9 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 1.9 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 2.5 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 25 2.5 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 25 2.5 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 25 2.5 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.3 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 24 4.3 AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 23 7.5 AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding pr... 23 7.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 10.0 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 573 INDVEFHSQVGSCYIKYVTKYFVELKIFSQV-D*HRARAVKLV 448 +ND+ SC YVT++ LK + V D H+ R V Sbjct: 912 LNDIRLAFNAWSCECDYVTRFQEYLKTYDFVRDRHKIRCASYV 954 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 25.0 bits (52), Expect = 1.9 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 VWT + S ++ Q T T + ++ PT T ++ + T S +PP PT Sbjct: 157 VWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPT 215 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 25.0 bits (52), Expect = 1.9 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 VWT + S ++ Q T T + ++ PT T ++ + T S +PP PT Sbjct: 157 VWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPT 215 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 89 TFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 T T ++ P +T ++ P +T PPC PT Sbjct: 113 TITRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPT 147 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 465 GRGVSLLVKKSLVPRNI*LHILCSTNRP 548 G G +L V +S+ RN+ H+ C+ RP Sbjct: 170 GYGTALGVIRSVNERNLLEHVYCTETRP 197 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 25.0 bits (52), Expect = 1.9 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 VWT + S ++ Q T T + ++ PT T ++ T S +PP PT Sbjct: 158 VWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTTTHAPTTTTTWSDLPPPPPT 216 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 2.5 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 +WT + S ++ Q T T + ++ PT T ++ T S +PP PT Sbjct: 158 IWTDPTTWSAPTTTTTWSDQPRPPTTTTTTVWTDPTATTTTHAPTTTTTWSDLPPPPPT 216 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 89 TFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 T T ++ P +T ++ P +T PPC PT Sbjct: 113 TVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPT 147 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 89 TFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 T T ++ P +T ++ P +T PPC PT Sbjct: 113 TVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPT 147 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 89 TFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 T T ++ P +T ++ P +T PPC PT Sbjct: 113 TVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPT 147 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.3 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 +WT + S ++ Q T T + ++ PT T ++ T S +PP PT Sbjct: 158 IWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPT 216 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 4.3 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +2 Query: 17 VWTTENSESLKV*ASS*RPQ*TVRTFTGSRIYRTPTTTCSSR*AGTPPIGSTVPPCQPT 193 +WT + S ++ Q T T + ++ PT T ++ T S +PP PT Sbjct: 158 IWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPT 216 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 464 RARCQSTCEKIFSSTKYLVTY 526 + R + +C+K F STK L Y Sbjct: 128 QGRYKDSCDKTFYSTKCLAEY 148 >AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 464 RARCQSTCEKIFSSTKYLVTY 526 + R + +C+K F STK L Y Sbjct: 126 QGRYKDSCDKTFYSTKCLAEY 146 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 487 TSRLTPRPCREASAAPVRFDPVPS 416 T R R R++ A + F P+PS Sbjct: 1199 TRRQRQRRARDSQAITIHFSPLPS 1222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,965 Number of Sequences: 2352 Number of extensions: 14266 Number of successful extensions: 49 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -