BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0832 (601 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18620.1 68414.m02321 expressed protein 32 0.33 At5g08550.1 68418.m01017 expressed protein 30 1.0 At3g24340.1 68416.m03056 SNF2 domain-containing protein / helica... 30 1.0 At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putativ... 29 2.4 At4g22250.1 68417.m03219 zinc finger (C3HC4-type RING finger) fa... 29 3.1 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 29 3.1 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 29 3.1 At3g06020.1 68416.m00687 expressed protein ; expression supporte... 27 9.5 At3g03560.1 68416.m00358 expressed protein 27 9.5 At3g01610.1 68416.m00092 AAA-type ATPase family protein contains... 27 9.5 >At1g18620.1 68414.m02321 expressed protein Length = 978 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/84 (26%), Positives = 39/84 (46%) Frame = +1 Query: 133 LEPLSRDSPDRVNGSSVPTDLALVNKHLEGLSVTSSGCSTPTGRKMRDPMQRDLQNSTFS 312 L+ + + R + P+D + + K + V S+ ++P GR+ R QR LQ + Sbjct: 564 LQQMKPEHDKRSRPPASPSDSSKLRKQISRQPVEST--TSPGGRRSRPRDQRSLQQNDGQ 621 Query: 313 ISKETEGLDTKTSVRVRNPPGGKS 384 +S+ + TK + GGKS Sbjct: 622 LSQMSNKSRTKIEATLSIENGGKS 645 >At5g08550.1 68418.m01017 expressed protein Length = 908 Score = 30.3 bits (65), Expect = 1.0 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 3/89 (3%) Frame = +2 Query: 260 DGK*GTPCRGTCKTPPSLSAKRLKDSTPRLRFAS-ATRRAASPPGSGRNRIKP--GRNRI 430 DGK TP T S K L S P+ + S A G+ R IKP GR+R+ Sbjct: 21 DGKVATPSSKPTSTLSSSKPKTLSASAPKKKLLSFADDEEEEEDGAPRVTIKPKNGRDRV 80 Query: 431 KPDRSRTSFTARARCQSTCEKIFSSTKYL 517 K + R ST E+ +S+ L Sbjct: 81 KSSSRLGVSGSSHRHSSTKERRPASSNVL 109 >At3g24340.1 68416.m03056 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|P41410 DNA repair protein rhp54 (RAD54 homolog) {Schizosaccharomyces pombe}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1132 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -1 Query: 253 GCYSRMTS--RSDLRDACSPGPGRLARRNR 170 GC + T R ++RDACSP P + RR R Sbjct: 39 GCVNSRTEKRRVNMRDACSPSPRKKKRRRR 68 >At5g57990.1 68418.m07255 ubiquitin-specific protease 23, putative (UBP23) identical to GI:11993486 Length = 859 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 160 DRVNGSSVPTDLALVNKHLEGLS-VTSSGCSTPTGRKMRDPMQRDLQNSTFSISKETEGL 336 D+VNGS+V + GL+ + S G STP +D ++ QN+ S + E L Sbjct: 443 DQVNGSTVIKECGFGALVANGLAPLKSCGPSTPAVLTQKDLNAKETQNNAISNVEAKEIL 502 Query: 337 DTK 345 +T+ Sbjct: 503 ETE 505 >At4g22250.1 68417.m03219 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 214 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 378 QVLRALVGTGSNPDGTGSNRTGAALASRHGRGVSLLVKKSLVPRNI 515 Q+ LV + GTG N A A R+ RG S + + PR + Sbjct: 83 QIETGLVLESDHGSGTGMNLATALEAERYNRGESTEAEADMTPRRV 128 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +2 Query: 296 KTPPSLSAKRLKDSTPRLRFASATRRAASPPGSGRNRIKPGRNRIKPDRSRTSFTARARC 475 ++PP S +R++ S R R RR + PP R R P R+ I+ RSR+ R Sbjct: 281 RSPPRGSPRRIRGSPVRRRSPLPLRRRSPPP--RRLRSPPRRSPIR-RRSRSPIRRPGRS 337 Query: 476 QST 484 +S+ Sbjct: 338 RSS 340 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +2 Query: 296 KTPPSLSAKRLKDSTPRLRFASATRRAASPPGSGRNRIKPGRNRIKPDRSRTSFTARARC 475 ++PP S +R++ S R R RR + PP R R P R+ I+ RSR+ R Sbjct: 288 RSPPRGSPRRIRGSPVRRRSPLPLRRRSPPP--RRLRSPPRRSPIR-RRSRSPIRRPGRS 344 Query: 476 QST 484 +S+ Sbjct: 345 RSS 347 >At3g06020.1 68416.m00687 expressed protein ; expression supported by MPSS Length = 300 Score = 27.1 bits (57), Expect = 9.5 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 3/102 (2%) Frame = +1 Query: 73 PINSPYVYGEQNLSHADHDLLEPLSRDSPDRVNGSSVPTDLALVNKHL---EGLSVTSSG 243 P +SP + + LE LS S + ++P + ++ E L++ + Sbjct: 60 PSSSPNPSSNSDTNSGSWSFLESLSNSSSNDKEKKTLPLFQSPSSRRTLSDESLALCTES 119 Query: 244 CSTPTGRKMRDPMQRDLQNSTFSISKETEGLDTKTSVRVRNP 369 + TG D + D+ FSIS E + ++T+T+ NP Sbjct: 120 LGSETGS---DIIHEDM----FSISSELQTMETRTTSTTSNP 154 >At3g03560.1 68416.m00358 expressed protein Length = 436 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 232 TSSGCSTPTGRKMRDPMQRDLQNSTFSISKETEGLDTKTSVRVRNPPGGKSSGLW*EP 405 T G T ++ PM+ +N +I ++TE S+R N GG S G++ +P Sbjct: 209 TDRGNDYQTNEQLLPPMENVTRNPYHNIMQDTE------SLRFNNQIGGGSQGIFPQP 260 >At3g01610.1 68416.m00092 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 820 Score = 27.1 bits (57), Expect = 9.5 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +1 Query: 91 VYGEQNLSHADHDLLEPLSRDSPDRVNGSSVPTDLALVNKHLEGLSVTSSGCS--TPTGR 264 VYGE+ LS DL+ RD+ ++N SS + K++E +V++ G S G Sbjct: 145 VYGEK-LSPPRFDLINDSLRDNYAKLNSSSKKPIGSPAEKNVEVETVSNKGRSKLATMGA 203 Query: 265 KMRDPMQRDLQNSTFSISKETEG 333 + + L +T + E EG Sbjct: 204 RKEAKVSLSLSGATGNGDLEVEG 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,202,150 Number of Sequences: 28952 Number of extensions: 299850 Number of successful extensions: 853 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -