BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0831 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32937| Best HMM Match : MFS_1 (HMM E-Value=5e-35) 29 3.8 SB_24767| Best HMM Match : DUF1566 (HMM E-Value=2.5) 28 8.9 >SB_32937| Best HMM Match : MFS_1 (HMM E-Value=5e-35) Length = 482 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 636 SLTYS*FLCLVSRSVQSCERY 698 SL ++ FLCL++ S Q CERY Sbjct: 61 SLQFATFLCLIAVSSQLCERY 81 >SB_24767| Best HMM Match : DUF1566 (HMM E-Value=2.5) Length = 283 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 702 FRIVHKIVQSVKLDIKITNTLNLNKYLKFTTQCLILKS 589 F + + S L ++++ +NL+KY QCL L++ Sbjct: 240 FAVAMRTCVSDPLGLRVSEAINLDKYFLLHAQCLYLEN 277 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,900,358 Number of Sequences: 59808 Number of extensions: 340644 Number of successful extensions: 645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -