BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0830 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 39 0.003 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 34 0.12 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 33 0.27 SB_32739| Best HMM Match : PA (HMM E-Value=0.19) 31 0.63 SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) 31 0.63 SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) 31 0.83 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 31 0.83 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17040| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 30 1.5 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 30 1.5 SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 30 1.9 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 29 4.4 SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) 29 4.4 SB_59005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_29935| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-06) 28 5.9 SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 7.7 SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERER 548 ++F R + LPEG PE V SR+S+ G L R P P E E+ Sbjct: 48 KEFRRTFTLPEGIDPENVTSRISNHGHLHIEARKALPKPEAELEK 92 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 272 KADKDKFQVNLDVQHFSPEEISVK 343 KA +DKF + +DV F PE I V+ Sbjct: 92 KAKEDKFSMAIDVAGFPPESIKVQ 115 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 278 DKDKFQV-NLDVQHFSPEEISVKTADGYI 361 D DKFQ+ LDV+ F PEEI+ K +G I Sbjct: 2 DADKFQIATLDVREFKPEEITCKVENGKI 30 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +3 Query: 381 KRRKTSTVYISRQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 +R ++ + S++F R Y LPEG ++ +R++ DG+L + P + E + Sbjct: 36 QRHESEEGFDSKEFRRCYNLPEGVDESSISTRIAEDGMLHVEALKKSPPATTENK 90 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 405 YISRQFVRRYALPEGAAPETVESRLSSDGVL 497 + +RQF R + LP +T+ RL DGVL Sbjct: 137 FTARQFNRHFVLPREVDMDTLVPRLGKDGVL 167 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 278 DKDKFQVNLDVQHFSPEEISVK 343 D KF + LDV F PEE+ VK Sbjct: 96 DDTKFTLALDVSDFKPEEVDVK 117 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 405 YISRQFVRRYALPEGAAPETVESRLSSDGVL 497 Y + +F R Y LP+G TV SR++ DG+L Sbjct: 78 YETSEFHRSYNLPDGVDVSTVSSRITGDGLL 108 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 257 LGSSIKADKDKFQV-NLDVQHFSPEEISVKTADGYI 361 L ++ + + DK ++ LDV+++ PEEIS+K G I Sbjct: 29 LAANTEMEGDKVEIATLDVKNYRPEEISLKVEHGRI 64 >SB_32739| Best HMM Match : PA (HMM E-Value=0.19) Length = 319 Score = 31.5 bits (68), Expect = 0.63 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +3 Query: 192 PVQCSPKTTSDRGDNSRLHLVTSAP---A*RPTRTSSKSIWTCSTS 320 P+ P++ R D R L S P A T T S S+WTCS S Sbjct: 273 PLDLKPRSNVMRVDEGRYELKLSCPFHCAFSHTLTDSHSLWTCSNS 318 >SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) Length = 2128 Score = 31.5 bits (68), Expect = 0.63 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 1/96 (1%) Frame = +3 Query: 342 RLPTGTSWWKASTKRRKTSTVYISRQFVRRYALP-EGAAPETVESRLSSDGVLPSPRRGR 518 R +G SW + RRK S ++R R + P E A E V+ R +D + P+ Sbjct: 940 RAISGRSWQDFESSRRKKSMELLNRPPSRTFETPAEPAKVEVVKLRRPADYI---PKHHG 996 Query: 519 YPTPSRERERCPLYRPGPVRKEIKDQSEGTQDAENK 626 ER P YR P E Q +Q +++ Sbjct: 997 SQELLNERPTSPTYRAKPQTYETHVQPMQSQPIQSE 1032 >SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) Length = 420 Score = 31.1 bits (67), Expect = 0.83 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +3 Query: 495 LPSPRRGRYPTPSRERERCPLYRPGPVRKE 584 LP P R RY R R R PLYR PVRK+ Sbjct: 55 LPRPPRIRYDINRRRRWRIPLYRE-PVRKK 83 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 31.1 bits (67), Expect = 0.83 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 245 ASRDLGSSIKADKDKFQVNLDVQHFSPEEISVK 343 A+++ S+ D KF + LDV F PEE+ VK Sbjct: 13 ATKENQSAATKDDTKFTLALDVSDFKPEEVDVK 45 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 250 RCSRELSPRSEVVFGEHWTGDGSQHVVR 167 R SR SP + FG TGDG QH+V+ Sbjct: 100 RASRTPSPSDSIDFGAVETGDGLQHLVK 127 >SB_17040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 500 ITAPRKVPDAVKGERKVPIVQTGSR 574 +T+ RKVP+ V +RKVP + TG R Sbjct: 42 VTSQRKVPNMVTSQRKVPNMVTGRR 66 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 494 STITAPRKVPDAVKGERKVPIVQTGSR 574 +T+T+ RKVP+ V RKVP T R Sbjct: 90 NTVTSQRKVPNMVSSRRKVPNTVTSRR 116 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 494 STITAPRKVPDAVKGERKVPIVQTGSR 574 +T+T+ RKVP+ V RKVP + T R Sbjct: 110 NTVTSRRKVPNMVTSRRKVPNMVTSRR 136 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 500 ITAPRKVPDAVKGERKVPIVQTGSR 574 +T+ RKVP+ V +RKVP + T R Sbjct: 32 VTSRRKVPNMVTSQRKVPNMVTSQR 56 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 500 ITAPRKVPDAVKGERKVPIVQTGSR 574 +T+ RKVP+ V R+VP + TG R Sbjct: 222 VTSRRKVPNMVTSRREVPNMVTGQR 246 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 500 ITAPRKVPDAVKGERKVPIVQTGSR 574 +T+ RKVP+ V RKVP + T R Sbjct: 2 VTSQRKVPNMVPSRRKVPNMVTSQR 26 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 500 ITAPRKVPDAVKGERKVP 553 +T+ RKVP+ V G RKVP Sbjct: 52 VTSQRKVPNMVTGRRKVP 69 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 ++F R +ALPEG V++R+S+ G L P P E Sbjct: 48 KEFRRTFALPEGVEASNVKTRISNHGQLHIEAMKALPGPDGGEE 91 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 275 ADKDKFQV-NLDVQHFSPEEISVKTADGYI 361 A+++K ++ LDV+ + PEEIS K +G++ Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFV 31 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 ++F R +ALPEG V++R+S+ G L P P E Sbjct: 48 KEFRRTFALPEGVEASNVKTRISNHGQLHIEAMKALPGPDGGEE 91 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 275 ADKDKFQV-NLDVQHFSPEEISVKTADGYI 361 A+++K ++ LDV+ + PEEIS K +G++ Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFV 31 >SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 29.9 bits (64), Expect = 1.9 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 1/95 (1%) Frame = +3 Query: 255 TSAPA*RPTRTSSKSIWTCSTSRRKRFR*RLPTGTSWWKASTKRRKTSTVYISRQFVRRY 434 T P RPT SKS + SR R T + +++ R++S+ I ++ R Sbjct: 452 TVRPKVRPTALPSKSGSRSAASRTSRSSRSRITSSGSTRSNRSNRRSSSASIDQE-TRSS 510 Query: 435 ALPEGAAPETVESRLSSDG-VLPSPRRGRYPTPSR 536 G E+ SDG VL RGR P++ Sbjct: 511 RRTRGRGVSYAETDSDSDGEVLTVSSRGRVRRPTQ 545 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 275 ADKDKFQV-NLDVQHFSPEEISVKTADGYI 361 A+++K ++ LDV+ + PEEIS K +G++ Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFV 31 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 ++F R + LPEG V++R+S+ G L P P E Sbjct: 48 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEAMKALPGPDGGEE 91 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 ++F R + LPEG V++R+S+ G L P P E Sbjct: 282 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEAMKALPGPDGGEE 325 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 284 DKFQV-NLDVQHFSPEEISVKTADGYI 361 D+ ++ LDV+ + PEEIS K +G++ Sbjct: 239 DELEIAKLDVREYRPEEISFKVENGFV 265 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 275 ADKDKFQV-NLDVQHFSPEEISVKTADGYI 361 A+++K ++ LDV+ + PEEIS K +G++ Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFV 31 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERE 545 ++F R + LPEG V++R+S+ G L P P E Sbjct: 48 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEAMKALPGPDGGEE 91 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 414 RQFVRRYALPEGAAPETVESRLSSDGVLPSPRRGRYPTP 530 ++F R + LPEG V++R+S+ G L P P Sbjct: 49 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEAMKALPEP 87 >SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2204 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 642 LQNHPTYFRHPGFPRSGP*SPCERDPVCTMGTFLSPLT 529 ++ H F +P F SP + DPVCT +S T Sbjct: 2096 MERHENEFTNPAFVLPSSSSPTDTDPVCTCEASVSLTT 2133 >SB_59005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 28.3 bits (60), Expect = 5.9 Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 2/89 (2%) Frame = +3 Query: 168 RTTCWLPSPVQCSPKTTSDRGDNSRLHLVTSAPA*RPTRTS--SKSIWTCSTSRRKRFR* 341 RT+ P PV+ S + S R R L TSA P RTS + S + ST R F Sbjct: 495 RTSSERPLPVRTSAERPSLRTSAERPSLRTSAERPLPVRTSTDTSSSFRSSTERPFSFHA 554 Query: 342 RLPTGTSWWKASTKRRKTSTVYISRQFVR 428 S W T +T ++ S +F R Sbjct: 555 DTERRESPW---TSTERTLSLRTSSEFDR 580 >SB_29935| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-06) Length = 353 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -1 Query: 274 LYAGAEVTRCSRELSPRSEVVFGE----HWTGDGSQH 176 LY+ V + +RE+ R ++ F E HWTG G H Sbjct: 83 LYSSGNVNQAAREMGKR-DIDFMEISETHWTGQGKMH 118 >SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.3 bits (60), Expect = 5.9 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = -3 Query: 473 RFHSLRRRAFRQRVTSDELP*NIHRARLS--SLRACLPPRCTRRQSSPKS---LPARSAA 309 R SL R+ R + + LP N+ +L SL+ PPR RR+ P+S P RS Sbjct: 126 RHQSLPRKQQRNPLPKNLLPKNLLPRKLQNPSLQRSQPPRNLRRKPPPRSPLKRPPRSKV 185 Query: 308 RP 303 P Sbjct: 186 LP 187 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 501 SPRRGRYPTPSRERERCPLYRPG 569 S + GR+PT +E + CP+Y+ G Sbjct: 77 SIKTGRFPTRWKEAKVCPIYKAG 99 >SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/61 (24%), Positives = 24/61 (39%) Frame = +3 Query: 432 YALPEGAAPETVESRLSSDGVLPSPRRGRYPTPSRERERCPLYRPGPVRKEIKDQSEGTQ 611 Y P P T ++ ++D V +P + PT E P+Y GP ++ Sbjct: 386 YDCPPRTVPSTGDAPANNDPVSNAPMMNKGPTSDASPESVPVY-DGPTNNSSANEDPSAT 444 Query: 612 D 614 D Sbjct: 445 D 445 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Frame = +3 Query: 471 SRLSSDGVLPSP---RRGRYPTPS--RERERCPLYRPGPVR 578 SR D PSP RR + P+PS R R R P P P+R Sbjct: 906 SRRRRDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPMR 946 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,410,029 Number of Sequences: 59808 Number of extensions: 470450 Number of successful extensions: 1661 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -