BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0830 (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 7.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.9 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 406 IFQGSSSDVTRCLKARRLRLWNRGC 480 +F G SD+ + L +W GC Sbjct: 245 MFTGLKSDIPPVAYVKALDVWMAGC 269 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = +3 Query: 489 GVLPSPRRGRYPTPSRERERCPLYRPGPVRKEIKDQS 599 G + P R P P C + G V + I+ S Sbjct: 1644 GYIAPPNRKLPPVPGSNYNTCDRIKRGTVIRSIRSHS 1680 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 490 GFYHHRAEEGTRR 528 GF+HHR E RR Sbjct: 982 GFWHHRLAEIKRR 994 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,085 Number of Sequences: 438 Number of extensions: 4100 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -