BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0829 (563 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48440.2 68418.m05990 FAD-dependent oxidoreductase family pro... 33 0.13 At5g48440.1 68418.m05989 FAD-dependent oxidoreductase family pro... 33 0.13 At5g34358.1 68418.m04025 hypothetical protein 32 0.30 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 31 0.53 At1g12170.1 68414.m01409 F-box family protein contains F-box dom... 29 1.6 At5g63750.1 68418.m08001 IBR domain-containing protein contains ... 29 2.8 At5g62570.1 68418.m07852 calmodulin-binding protein similar to c... 28 3.7 At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)... 28 3.7 At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)... 28 3.7 At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR... 28 5.0 At3g12570.3 68416.m01566 expressed protein 28 5.0 At3g12570.2 68416.m01565 expressed protein 28 5.0 At3g12570.1 68416.m01564 expressed protein 28 5.0 At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 28 5.0 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 28 5.0 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 27 6.5 At4g01640.1 68417.m00213 hypothetical protein 27 6.5 At2g34280.1 68415.m04194 S locus F-box-related / SLF-related con... 27 6.5 At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family... 27 6.5 At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containi... 27 8.7 At1g06040.1 68414.m00632 zinc finger (B-box type) family protein... 27 8.7 >At5g48440.2 68418.m05990 FAD-dependent oxidoreductase family protein low similarity to hydrogen cyanide synthase HcnC from Pseudomonas fluorescens [GI:3220203]; contains Pfam profile PF01266 FAD dependent oxidoreductase Length = 333 Score = 33.1 bits (72), Expect = 0.13 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +3 Query: 102 GWKQCGSLLLARTRDRMTVYRRMKSQSVSWSIDCDLVTPKKCHELFPMLNVEDVLGGLWI 281 GWK+ GSLL+ RT + ++ + + + ++ + P + V D G ++ Sbjct: 40 GWKKTGSLLIGRTTEECVALKQKVHELSEAGLRTEYLSSAELLLKEPAILVNDNTGAAFL 99 Query: 282 PGDGVGDPH 308 P D D H Sbjct: 100 PDDSQLDAH 108 >At5g48440.1 68418.m05989 FAD-dependent oxidoreductase family protein low similarity to hydrogen cyanide synthase HcnC from Pseudomonas fluorescens [GI:3220203]; contains Pfam profile PF01266 FAD dependent oxidoreductase Length = 367 Score = 33.1 bits (72), Expect = 0.13 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +3 Query: 102 GWKQCGSLLLARTRDRMTVYRRMKSQSVSWSIDCDLVTPKKCHELFPMLNVEDVLGGLWI 281 GWK+ GSLL+ RT + ++ + + + ++ + P + V D G ++ Sbjct: 40 GWKKTGSLLIGRTTEECVALKQKVHELSEAGLRTEYLSSAELLLKEPAILVNDNTGAAFL 99 Query: 282 PGDGVGDPH 308 P D D H Sbjct: 100 PDDSQLDAH 108 >At5g34358.1 68418.m04025 hypothetical protein Length = 116 Score = 31.9 bits (69), Expect = 0.30 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -2 Query: 340 VASLIRDIQSKCGSPTPSPGIHRPPSTSST 251 +A+ I+D QSK P+P P + R STSST Sbjct: 1 MAAQIKDFQSKPRPPSPIPKVRRSGSTSST 30 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 31.1 bits (67), Expect = 0.53 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Frame = -2 Query: 493 NCPTCLAQKPAQLIK*SHSIAPFVVSTPDTLSSFDSTAVTEQSSITPTPLSVASLIRDIQ 314 NC TCL ++++ + + TP L +++TA++ P+P +S + Sbjct: 215 NCTTCLKLAVQEMLECCNQSRWAQIFTPKCLLRYEATALSSPPPPYPSPPPPSSPL---- 270 Query: 313 SKCGSP-TPSPGIHRPPSTSSTFSIGNNS 230 SP PSP + + P T+S FS G++S Sbjct: 271 ---FSPLLPSPPLFKRPQTASGFS-GSSS 295 >At1g12170.1 68414.m01409 F-box family protein contains F-box domain Pfam:PF00646 Length = 364 Score = 29.5 bits (63), Expect = 1.6 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 356 CDGRLFCDSCAIERRQSVWS 415 CDG LFCDS + ++ ++W+ Sbjct: 98 CDGLLFCDSWSWRKKAAIWN 117 >At5g63750.1 68418.m08001 IBR domain-containing protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam:PF01485 IBR domain Length = 536 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 293 CRRPAFALYVSYERSN**RCGCDGRLFCDSCAI-ERRQSVWSGNYKWCN 436 C RPA Y R C C+GR FC C E SG YK+CN Sbjct: 280 CLRPADLGTKQYLRFL--TCACNGR-FCWKCMQPEEAHKTESGFYKFCN 325 >At5g62570.1 68418.m07852 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 487 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 115 HCFHPVGLPRASSSLRSLIEDWASLT*ASVGLNAPTR 5 +C H +GL S L+S ++D+ S ASVG A ++ Sbjct: 428 NCSHILGLEEPQSELQSALDDFMSQKNASVGGKAHSK 464 >At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12) identical to cDNA DEAD box RNA helicase, RH12 GI:3776000 Length = 498 Score = 28.3 bits (60), Expect = 3.7 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 7/78 (8%) Frame = +3 Query: 207 LVTPKKCHELFPMLNVEDVL--GGLWIPGD--GVGDP-HLLCMSLMR--EATDKGVGVME 365 L T + C EL LN++ ++ GG + D + P HLL + R + T KGV V++ Sbjct: 206 LQTSQVCKELSKYLNIQVMVTTGGTSLRDDIMRLHQPVHLLVGTPGRILDLTKKGVCVLK 265 Query: 366 DCSVTAVLSKDDKVSGVE 419 DC++ V+ + DK+ E Sbjct: 266 DCAM-LVMDEADKLLSAE 282 >At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12) identical to cDNA DEAD box RNA helicase, RH12 GI:3776000 Length = 498 Score = 28.3 bits (60), Expect = 3.7 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 7/78 (8%) Frame = +3 Query: 207 LVTPKKCHELFPMLNVEDVL--GGLWIPGD--GVGDP-HLLCMSLMR--EATDKGVGVME 365 L T + C EL LN++ ++ GG + D + P HLL + R + T KGV V++ Sbjct: 206 LQTSQVCKELSKYLNIQVMVTTGGTSLRDDIMRLHQPVHLLVGTPGRILDLTKKGVCVLK 265 Query: 366 DCSVTAVLSKDDKVSGVE 419 DC++ V+ + DK+ E Sbjct: 266 DCAM-LVMDEADKLLSAE 282 >At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1193 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 69 LKELEARGRPTGWKQCGSLLLARTRDR 149 L++L+A + TGW GS ++ T+DR Sbjct: 322 LEQLDAMAKETGWFGYGSRIIITTQDR 348 >At3g12570.3 68416.m01566 expressed protein Length = 489 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 8/57 (14%) Frame = +2 Query: 98 HRVETMWFTIIGKNKRPHDCL--------QKNEKSVCIVEHRL*LSYTKEMS*IISN 244 H V+T+ + G NKR DCL +EKS+ + H L ++ + S ++ N Sbjct: 300 HAVDTVEVQLAGSNKRKRDCLALGNCDDSSSSEKSLDMKIHATELPWSNDFSGVMKN 356 >At3g12570.2 68416.m01565 expressed protein Length = 489 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 8/57 (14%) Frame = +2 Query: 98 HRVETMWFTIIGKNKRPHDCL--------QKNEKSVCIVEHRL*LSYTKEMS*IISN 244 H V+T+ + G NKR DCL +EKS+ + H L ++ + S ++ N Sbjct: 300 HAVDTVEVQLAGSNKRKRDCLALGNCDDSSSSEKSLDMKIHATELPWSNDFSGVMKN 356 >At3g12570.1 68416.m01564 expressed protein Length = 489 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 8/57 (14%) Frame = +2 Query: 98 HRVETMWFTIIGKNKRPHDCL--------QKNEKSVCIVEHRL*LSYTKEMS*IISN 244 H V+T+ + G NKR DCL +EKS+ + H L ++ + S ++ N Sbjct: 300 HAVDTVEVQLAGSNKRKRDCLALGNCDDSSSSEKSLDMKIHATELPWSNDFSGVMKN 356 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 27.9 bits (59), Expect = 5.0 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = -2 Query: 445 SHSIAPFVVSTPDTLSSFDSTAVTEQSSITP--TPLSVASLIRDIQSKCGSPTPSPGIHR 272 SHS P S+P T S S AV+ S + +P+ S + SP+PSP Sbjct: 173 SHSSPPVSHSSPPTSRS--SPAVSHSSPVVAASSPVKAVSSSTASSPRAASPSPSPS--- 227 Query: 271 PPSTSST 251 PS SS+ Sbjct: 228 -PSISSS 233 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = -2 Query: 535 CSHGSKGT----FTCGRANCPTCLAQKPAQLIK*SHSIAPFVVSTPDTLSSFDSTAVTEQ 368 CSH + + R+ CP C A P + +S+ PF+ P D VT + Sbjct: 147 CSHAFHASCIDVWLSSRSTCPVCRASLPPKPGSDQNSLYPFI--RPHDNQDMDLENVTAR 204 Query: 367 SSITPTP 347 S+ +P Sbjct: 205 RSVLESP 211 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 27.5 bits (58), Expect = 6.5 Identities = 22/76 (28%), Positives = 30/76 (39%) Frame = -2 Query: 481 CLAQKPAQLIK*SHSIAPFVVSTPDTLSSFDSTAVTEQSSITPTPLSVASLIRDIQSKCG 302 CL +PAQ + A F P SF T + P+P + S S Sbjct: 371 CLPARPAQ--RSPGQCAAFSSLPPVDCGSFGCGRSTRPPVVVPSPPTTPSPGGSPPSPSI 428 Query: 301 SPTPSPGIHRPPSTSS 254 SP+P + PP+T S Sbjct: 429 SPSPPITVPSPPTTPS 444 >At4g01640.1 68417.m00213 hypothetical protein Length = 300 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +3 Query: 123 LLLARTRDRMTVYRRMKSQSVSWSIDCDLVTPKKCHELFPMLNVEDVLGG 272 L++ DR+ V +M V WS+D D T K+ + + LN+ L G Sbjct: 190 LIMCNLDDRLCVSEKMWPNQVIWSLDSDHKTWKEIYSI--DLNITSSLFG 237 >At2g34280.1 68415.m04194 S locus F-box-related / SLF-related contains Pfam PF00646: F-box domain; contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain; weakly similar to self-incompatibility (S-) locus F-box (GI:29420811) [Prunus mume] Length = 391 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +3 Query: 123 LLLARTRDRMTVYRRMKSQSVSWSIDCDLVTPKKCHELFPMLNVEDVLGG 272 L++ DR+ V +M V WS+D D T K+ + + LN+ L G Sbjct: 281 LIMCNLDDRLCVSEKMWPNQVIWSLDSDHKTWKEIYSI--DLNITSSLFG 328 >At2g28240.1 68415.m03428 hydroxyproline-rich glycoprotein family protein Length = 660 Score = 27.5 bits (58), Expect = 6.5 Identities = 26/92 (28%), Positives = 35/92 (38%) Frame = -2 Query: 463 AQLIK*SHSIAPFVVSTPDTLSSFDSTAVTEQSSITPTPLSVASLIRDIQSKCGSPTPSP 284 A+L+ HS P P +T + S+ P PL A QS C +P P P Sbjct: 445 ARLLHQPHSNTPQPRPIPQKALVQANTDIN--STALPRPLVTAEAPPLHQSSCKAPQPKP 502 Query: 283 GIHRPPSTSSTFSIGNNS*HFFGVTKSQSMLH 188 +P S T I + + VT LH Sbjct: 503 ISQQPAVQSKTDIINSTALPRPSVTTEARPLH 534 >At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 695 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 60 IRLLKELEARGRPTGWKQCGSLLLAR 137 +RLL+ +R R T W+Q LLL + Sbjct: 30 VRLLQSCSSRNRETLWRQTNGLLLKK 55 >At1g06040.1 68414.m00632 zinc finger (B-box type) family protein / salt-tolerance protein (STO) identical to SP|Q96288 Salt-tolerance protein [Arabidopsis thaliana]; contains Pfam profile PF00643: B-box zinc finger Length = 248 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 429 GAIECDYFINCAGFWARQVGQLARPQVKVPLLPCEHY-YLHT-KPI 560 GA E D+F + GF+ Q+ A P +VP L H ++H+ KP+ Sbjct: 175 GAGELDWFSDM-GFFGDQINDKALPAAEVPELSVSHLGHVHSYKPM 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,282,137 Number of Sequences: 28952 Number of extensions: 289042 Number of successful extensions: 946 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -