BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0824 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.52 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 27 0.68 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.2 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 1.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 1.6 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 2.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 3.7 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.8 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 24 4.8 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 27.1 bits (57), Expect = 0.52 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 618 GLGPSFLESSSLSVTGETGEVSSCRTGVTEACTRV 514 G+G F L++ G TG V T V E C +V Sbjct: 567 GIGYGFFSGQPLTILGSTGPVLVFETIVYEFCQKV 601 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 26.6 bits (56), Expect = 0.68 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +2 Query: 170 SEIDSPVGTPQPPAIPNQVSPP-------GPIPTQTFTNQHYVQ 280 S + SP G+ +P+Q PP GPIP+Q QH Q Sbjct: 216 STLSSPSGSRMEYLLPHQQHPPGAGVQGAGPIPSQQKHQQHQQQ 259 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.2 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = +2 Query: 485 HHTMQPALVATLVHASVTPVLQEDTSPVSPVT------DKEDDSRKDGPSPELENGG 637 ++ M+ +++T + + + +ED P +P T ++E+ R G +PE E+GG Sbjct: 1514 YNNMRTGVISTAIPEANS---EEDIVPPAPATATTKSVEREEPVRASGKAPESESGG 1567 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 468 LHLSPYITQCNPLSSRLWYT 527 + L Y C PLSSR W T Sbjct: 202 ISLERYFAICRPLSSRRWQT 221 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.4 bits (53), Expect = 1.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 188 VGTPQPPAIPNQVSPPG 238 +GTP PP P V P G Sbjct: 145 LGTPGPPGYPGDVGPKG 161 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.0 bits (52), Expect = 2.1 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +2 Query: 152 FFFLQESEIDSPVGTP-----QPPAIPNQVSPPGPIPT 250 FF L +++ P G P QPP P P GP P+ Sbjct: 559 FFPLNPAQLRFPAGFPNLPNAQPPPAPPPPPPMGPPPS 596 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 578 TDKEDDSRKDGPSPELEN 631 +DKEDD DG ++EN Sbjct: 1728 SDKEDDDGDDGEDDDVEN 1745 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 489 TQCNPLSSRLWYTPL 533 TQCNPLS+ L+ T L Sbjct: 28 TQCNPLSTYLYRTIL 42 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.8 bits (49), Expect = 4.8 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 382 AHAARTYAPARSSARQS-TAPAAACHARRPSTSARTSHNATRS 507 A AA A ++A + TAPAA + + +A T+H AT S Sbjct: 198 AFAATNAASVATAAPAAITAPAANAASTAAAPAAATAHAATAS 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,175 Number of Sequences: 2352 Number of extensions: 12598 Number of successful extensions: 114 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -