BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0818 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pomb... 26 5.9 SPAC139.05 |||succinate-semialdehyde dehydrogenase |Schizosaccha... 25 7.8 >SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pombe|chr 2|||Manual Length = 240 Score = 25.8 bits (54), Expect = 5.9 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 464 VQRLCFIFPHLCTFTDNK-QLINHHYYTFKPE 372 +Q++C +F H T D + Q++ Y+ PE Sbjct: 161 LQQICVVFKHKQTSQDTRFQILEFFYFYLSPE 192 >SPAC139.05 |||succinate-semialdehyde dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 493 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 130 YEMKSNLSKMVVIY*DFFSGLFGGSREVTSSGFVSF 23 Y +NLS M+ + + GL G + E+ F+SF Sbjct: 427 YVFTNNLSTMIHVAKELEVGLVGANIEMVDEPFISF 462 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,253,440 Number of Sequences: 5004 Number of extensions: 38228 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -