BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0813 (809 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 46 0.001 UniRef50_A2G610 Cluster: Ankyrin repeat protein, putative; n=1; ... 33 6.4 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 696 FLML*WVDELTAYLVLSGYWSP 631 FL+L WVDELTA+LVLSGYWSP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_A2G610 Cluster: Ankyrin repeat protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ankyrin repeat protein, putative - Trichomonas vaginalis G3 Length = 710 Score = 33.5 bits (73), Expect = 6.4 Identities = 19/56 (33%), Positives = 33/56 (58%) Frame = +2 Query: 563 AAILEALKLISQGGWRIYIIDIYGLQ*PLNTR*AVSSSTHQSIKNKIKNPLSTLVN 730 A ++ +KL+ + G + IIDI + P T A++S + QSI+ ++N + LVN Sbjct: 434 ADAIDCVKLLIESGADVNIIDIQNRETPFMT--AINSQSEQSIRELLQNADADLVN 487 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 682,767,766 Number of Sequences: 1657284 Number of extensions: 11980171 Number of successful extensions: 22028 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22024 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69966202150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -