BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0812 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 26 1.3 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 25 3.0 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 6.8 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 9.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.0 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 383 LEPGLCSPTVCHGPQRGLRG*TRSQRCP*CVATVSRGLDC 264 L+P L T+C G G+ ++Q C C A V GL+C Sbjct: 4 LKPILSYVTLC-GEVTGVSYRGQAQTCRNCAAPVHHGLNC 42 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 215 MGKNTMMRKAIKDHLDNNPALEKLLPHIKGNVGFV 319 M +NT ++ A+ HL NNP ++ L +K V V Sbjct: 102 MFQNTTLQ-AVLSHLRNNPITDEHLAKVKRGVEIV 135 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 157 GLATDAADPYLATWLQYRAHGKKHYDAQSHQR 252 G ATD + LA Q + H +H Q HQ+ Sbjct: 293 GSATDNNNYILAQQQQQQHHHHQHQPQQQHQQ 324 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 427 GGNDD*QWGNGTGTSWSLDFVLQQFV-TDLNEVSAGEH 317 GGND +W + G +W L + FV D ++ G++ Sbjct: 287 GGNDALRWLSNFGEAWRLLASREAFVFVDNHDNQRGDY 324 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 626 LLNNKTIMRMERCSTC 579 + NN ++MR+E C C Sbjct: 3003 ITNNNSVMRLEYCIDC 3018 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,340 Number of Sequences: 2352 Number of extensions: 17489 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -