BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0807 (740 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|ch... 28 1.6 SPCC4B3.15 |mid1|dmf1|medial ring protein Mid1|Schizosaccharomyc... 27 2.1 SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pom... 26 6.5 >SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 750 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/57 (28%), Positives = 31/57 (54%) Frame = +2 Query: 464 QDIRPFGQCNFSDIRPCYNSNDLRLDFGIAGS*ATCMKKLTQRAVNELCS*LNFLKI 634 QD++ G+ ++S++ Y + L+ + S A C+ Q +NEL S ++ LK+ Sbjct: 547 QDLKQAGENHYSNLSSDYETQIKSLESSLTNSQAECVS--FQEKINELNSQIDELKL 601 >SPCC4B3.15 |mid1|dmf1|medial ring protein Mid1|Schizosaccharomyces pombe|chr 3|||Manual Length = 920 Score = 27.5 bits (58), Expect = 2.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 178 DEKNRYCQTFELSKTAVNLIAFSSYENLFRLFLLYGIFA 294 ++ +Y TF+LSKT V++ + E + L L+ GI A Sbjct: 833 EKGGQYLDTFQLSKTVVSIPMVNFSEAVSNLGLVAGILA 871 >SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 412 Score = 25.8 bits (54), Expect = 6.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 311 YNCKIFAKIPYNKNNRNKFSYELK 240 Y C+I K P N + + F+Y+L+ Sbjct: 271 YACRIIRKTPLNLSEKKFFAYQLQ 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,712,782 Number of Sequences: 5004 Number of extensions: 51752 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -