BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0807 (740 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40677| Best HMM Match : DUF855 (HMM E-Value=2.6) 29 4.0 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_51369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 399 SIEVNI*IHR*SRYFCFNTVMCKILGHLDNV 491 +I V++ IH R FC V+C + HLDNV Sbjct: 30 TINVDV-IHSSKRLFCSKIVVCNNITHLDNV 59 >SB_40677| Best HMM Match : DUF855 (HMM E-Value=2.6) Length = 153 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = -2 Query: 460 ITVLKQKYLDHLCI*ILTSMESPYYLSQFNFWVLFFNVTRYPEKT*LLENIIARFLQKSR 281 I V K+++ DH+ + ++T + + +Y+ +F FN T++ K + + F + Sbjct: 48 IYVSKERFEDHIELLLITEVSNKHYVLIKDFNKFMFNQTKHEHKKHFCMSCLQCFSSERV 107 Query: 280 TTKIIE 263 T IE Sbjct: 108 LTNYIE 113 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 157 EKSKEIKDEKNRYCQTFELSKTAVNLIAFSSYE 255 EK+KE++DEK R ELS+ V+ + S E Sbjct: 850 EKAKELEDEKGRILDIVELSRKYVSELETSLAE 882 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,347,842 Number of Sequences: 59808 Number of extensions: 350057 Number of successful extensions: 672 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -