BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0806 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15) 29 3.1 SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) 29 4.1 SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 28 5.5 SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) 28 5.5 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 28 5.5 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) 27 9.6 >SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15) Length = 373 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 5/39 (12%) Frame = +2 Query: 2 SSRQLHGCRRSLFRTGQKPKT---YPF*RNS-QC-ETRY 103 +S + GC SL GQ PK+ +PF R++ QC E+RY Sbjct: 58 NSTAIFGCNMSLLNKGQSPKSRRVHPFARHAGQCAESRY 96 >SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) Length = 535 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +3 Query: 309 EVIRIVEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYI 488 E I + ++ NN + + GG + +E S E+ N V WEN + YI Sbjct: 101 ETINVTGNYWLPSNNVLELKYLRDIGGVTWTDNCAECCLSKETSQNSVTWENLRSEMYYI 160 Query: 489 GTD 497 G + Sbjct: 161 GIE 163 >SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 214 TSSPTSNPHAPTGATSSSLNTLLGGKKTT--CPTK 312 T S T P PT + +SS + GG KTT C T+ Sbjct: 353 TGSRTRTPPTPTSSRASSRGSARGGAKTTKKCTTR 387 >SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 765 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 223 PTSNPHAPTGATSSSLNTLLGGKKTTCPT 309 P S H+P +T S+NT+L + CP+ Sbjct: 703 PVSRYHSPRPSTCLSINTILHDQARACPS 731 >SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) Length = 186 Score = 28.3 bits (60), Expect = 5.5 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +3 Query: 60 KLTLF-KEIRSVKPDTM--KLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANL 230 KL +F K+ PD + ++++ S ++ RE W + PI + + + +L Sbjct: 96 KLQIFVKQKLEGVPDKIMGRVVLGTSAEDLEREHWNEAMTAKKPIARWHSLREFH--NSL 153 Query: 231 KPTRPNRCYKFLA 269 PTRPNR K +A Sbjct: 154 LPTRPNRTSKPIA 166 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 135 EFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTR 242 E RET R E+ FP++ E+ L+ LK T+ Sbjct: 170 ESCRETGKRVAEELFPVIAQDELSTPLLMGKLKRTK 205 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 500 RVCADVNDGFVEVLPYDAVHKRLERVGVLAVDVHDWAAA 384 R D + GF+E L Y KRLE G L H+W ++ Sbjct: 326 RSLTDHSKGFIEKLLYKIPSKRLEVAGAL---THEWLSS 361 >SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) Length = 660 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 220 SPTSNPHAPTGATSSSLNTLLGGKKTTCPTK 312 S T P PT + +SS + GG KTT TK Sbjct: 578 SRTRTPPTPTSSRASSRGSAGGGAKTTKTTK 608 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,780,459 Number of Sequences: 59808 Number of extensions: 475073 Number of successful extensions: 1336 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -