BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0804 (612 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.40 SPAC25G10.08 |||translation initiation factor eIF3b |Schizosacch... 27 1.6 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 27 1.6 SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein T... 27 2.8 SPBC1271.14 |||glutamate N-acetyltransferase |Schizosaccharomyce... 27 2.8 SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|c... 27 2.8 SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|... 26 3.7 SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosacchar... 26 3.7 SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr... 26 4.9 SPAP27G11.05c |vps41||vacuolar protein sorting-associated protei... 25 6.5 SPAC20H4.06c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 8.6 SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 25 8.6 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.5 bits (63), Expect = 0.40 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = -2 Query: 185 WPIYRASPVLSSAYQCMPSIDSMSLIYRMKSVGESTEPCGTPALMV 48 WP Y Y + S+ L YR KSV ES EP G P L + Sbjct: 116 WPSYVRFVDFDERYTRFANKYSLYL-YREKSVEESDEPSGIPILFI 160 >SPAC25G10.08 |||translation initiation factor eIF3b |Schizosaccharomyces pombe|chr 1|||Manual Length = 725 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 414 RHFERCPVSESFGRQSQVGVLNAGSPQ 494 ++FE CPVS++ GR S+ +L +P+ Sbjct: 353 QNFEWCPVSDALGRDSKEQLLAYWTPE 379 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 27.5 bits (58), Expect = 1.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 236 DTSFDRLSCTALRERL*WPIYRASPVLSSAYQCM 135 + SF+ L CT R RL P+ +P+ Y C+ Sbjct: 614 EASFEELPCTCGRTRLYPPVACGTPIPDCPYLCV 647 >SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein Trt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 988 Score = 26.6 bits (56), Expect = 2.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 61 GVPQGSVLSPTLFILYINDML 123 G+PQGS+LS L Y+ D++ Sbjct: 703 GIPQGSILSSFLCHFYMEDLI 723 >SPBC1271.14 |||glutamate N-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 445 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 320 ARSLRRRTPLSWRRNSKEYPCNLPRVSGYLGSTFR 424 A +L R SW NS+E+P +L +G +G + Sbjct: 124 ADNLTRPHWTSWTENSEEFPSSLVMSTGVIGQRLK 158 >SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 26.6 bits (56), Expect = 2.8 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 222 SSLLHRAPRETLMADISRIP 163 S+++ R P ET +AD+SR+P Sbjct: 441 SAVITRNPSETSLADLSRVP 460 >SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 119 MSLIYRMKSVGESTEPCGTPALMVMVSEQ 33 MSL+Y +SVG T PCG+ + ++ Q Sbjct: 1 MSLVYLFQSVGILT-PCGSAGAIAYITSQ 28 >SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 807 Score = 26.2 bits (55), Expect = 3.7 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 61 GVPQGSVLSPTLFILYINDM 120 G PQGS++SP L +Y++ + Sbjct: 420 GTPQGSIVSPILANIYLHQL 439 >SPBP8B7.04 |mug45||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 819 Score = 25.8 bits (54), Expect = 4.9 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -1 Query: 345 GVLLRSERANLCLYRVELN*VQFTPFGDS 259 G+L++ ER NL YRV L QF P DS Sbjct: 688 GILIKPERYNLFKYRVYL--PQFLPPTDS 714 >SPAP27G11.05c |vps41||vacuolar protein sorting-associated protein Vps41|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 70 QGSVLSPTLFILYINDMLSIDGMHWY 147 + S L+ +L LY+ D + ID H Y Sbjct: 502 KSSTLTESLAFLYLEDNMPIDAFHLY 527 >SPAC20H4.06c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 534 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 353 WRRNSKEYPCNLPRVSGYLGSTFRAMSSFGVIWKAKPSWRPKCWESSTEQS 505 W++ +++ N R G F A F + +K W+PK W+SS ++ Sbjct: 39 WKQEARDER-NRKRFHGAFTGGFSA-GYFNTVG-SKEGWQPKSWKSSRNEN 86 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 37 SDTMTINAGVPQGSVLSPTLFILYINDMLSI 129 S +T+ + VP+ S FI Y + +LSI Sbjct: 39 SSRLTVRSAVPEKSAFGSIEFIFYFSVILSI 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,851,280 Number of Sequences: 5004 Number of extensions: 63401 Number of successful extensions: 210 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -