BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0803 (741 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.11 |syb1||synaptobrevin |Schizosaccharomyces pombe|chr 1... 65 1e-11 SPBC13G1.11 |ykt6||SNARE Ykt6|Schizosaccharomyces pombe|chr 2|||... 35 0.014 SPAP8A3.13c |||Vid 24 family protein|Schizosaccharomyces pombe|c... 25 8.6 SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces p... 25 8.6 >SPAC6G9.11 |syb1||synaptobrevin |Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 64.9 bits (151), Expect = 1e-11 Identities = 27/78 (34%), Positives = 48/78 (61%) Frame = +2 Query: 92 GGSSAPRVSDKRLAQTQAKVDEVVGIMRVNVEKVLERDQKLSELDNRADALQHGAAQFEQ 271 G ++A + + A Q ++D+ VGIMR N+ KV ER ++L L ++ D L A F + Sbjct: 20 GNAAASSTPNMKTAAIQQQIDDTVGIMRENISKVSERGERLDSLQDKTDNLAVSAQGFRR 79 Query: 272 QAGKLKRKYWWQNLKMML 325 A ++++K WW++++M L Sbjct: 80 GANRVRKKMWWKDMRMRL 97 >SPBC13G1.11 |ykt6||SNARE Ykt6|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 34.7 bits (76), Expect = 0.014 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +2 Query: 107 PRVSDKRLAQTQAKVDEVVGIMRVNVEKVLERDQKLSELDNRADALQHGAAQFEQQAGK 283 P+ +D + + Q ++DE ++ +E VL R +KL +L R+D L + F + A K Sbjct: 132 PKQADT-IMRVQQELDETKDVLHKTIESVLARGEKLDDLIQRSDNLSTQSRMFYKSAKK 189 >SPAP8A3.13c |||Vid 24 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 547 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +1 Query: 133 TNTSQSR*SCWHYACQCRES 192 T+TS+SR + +++ C CRE+ Sbjct: 493 TDTSESRITGFYFCCLCREN 512 >SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.4 bits (53), Expect = 8.6 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 522 SSRAWSFLNPDPSHNKYFLEYMF-KLANYR 436 S+RAWS L+ P LEYMF + +YR Sbjct: 104 SNRAWSRLSGLPVDKLLVLEYMFYQCIDYR 133 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,762,817 Number of Sequences: 5004 Number of extensions: 53492 Number of successful extensions: 149 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -