BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0795 (700 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069401-1|AAL39546.1| 112|Drosophila melanogaster LD10305p pro... 29 6.1 AE014134-2672|AAF53503.2| 248|Drosophila melanogaster CG4959-PB... 29 8.0 >AY069401-1|AAL39546.1| 112|Drosophila melanogaster LD10305p protein. Length = 112 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -1 Query: 493 FIYFCTVDVDYLFTEYFILRAVNSNRNVLLLYSRNRQGGGISSYGLTQCLTTSKIACRRW 314 F FC V + L + ILR +N + L S + G S + L LT + ++C RW Sbjct: 31 FAIFCIVCLAILLPKLLILRWINPISHNRLHSSGS--GECFSEFSLEAWLTVATVSCWRW 88 >AE014134-2672|AAF53503.2| 248|Drosophila melanogaster CG4959-PB protein. Length = 248 Score = 28.7 bits (61), Expect = 8.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 563 KRTVCVSMAYVDYLL*TTQCIIYIFKCEITGNPTRRIRYLVKC 691 +R V++A+ + T +Y ++ T NPT IR ++KC Sbjct: 118 RRAELVALAHYSFGSPTENIYLYDYQISRTENPTSVIRLIIKC 160 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,089,257 Number of Sequences: 53049 Number of extensions: 730221 Number of successful extensions: 1977 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1977 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -