BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0793 (576 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0036 + 25786530-25786756,25788000-25788076,25788538-257886... 31 0.50 06_03_1338 - 29440373-29440534,29440993-29441083,29441799-294419... 30 1.1 06_03_0365 + 19918003-19918401 29 3.5 01_06_0753 - 31711300-31713066 29 3.5 07_01_0893 + 7484598-7484744,7484837-7484902,7494387-7494530,749... 28 6.1 >01_06_0036 + 25786530-25786756,25788000-25788076,25788538-25788625, 25788706-25788786,25788866-25788940,25789048-25789149, 25789589-25789726,25791559-25791585,25791696-25791786, 25792423-25792584 Length = 355 Score = 31.5 bits (68), Expect = 0.50 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 15 IKDIVQAIRWVKDNIHHFGGNAGNLTIFGESAGARAVSLLTASPLTKNLISKAI 176 + D Q I +V +NI +GG+ + + G+SAGA + K ++I Sbjct: 194 VSDASQGISYVCNNIASYGGDPNRIYLVGQSAGAHIAACALIEQAVKESSGQSI 247 >06_03_1338 - 29440373-29440534,29440993-29441083,29441799-29441942, 29442094-29442159,29442589-29442729,29443077-29443178, 29443264-29443338,29443469-29443549,29443670-29443739, 29444063-29444139,29444392-29444660 Length = 425 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 15 IKDIVQAIRWVKDNIHHFGGNAGNLTIFGESAGA 116 ++D Q I +V +NI +GG+ + + G+SAGA Sbjct: 202 VEDASQGIAFVCNNIASYGGDPERIYLVGQSAGA 235 >06_03_0365 + 19918003-19918401 Length = 132 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/32 (40%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = -3 Query: 178 IIALLIKFLVNGLAV---SNETARAPALSPNI 92 ++A+L+ LV+ L+V +++ ARAPAL+P++ Sbjct: 9 LVAVLLLLLVSSLSVRAEADQVARAPALAPDV 40 >01_06_0753 - 31711300-31713066 Length = 588 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 134 QQRNRTRARAFTKYCQITGITTEVMDIIFHPSNGLNYIFD-TSIP 3 Q+ N+ + TKY + G T V + + + SNGL + D T+IP Sbjct: 535 QRLNKFQKLWLTKYSDLVGHLTRVAECMTYLSNGLQRLKDSTTIP 579 >07_01_0893 + 7484598-7484744,7484837-7484902,7494387-7494530, 7494860-7495235,7495904-7496017,7496282-7496454, 7496562-7496669,7497311-7497377,7497791-7497904, 7498121-7498257,7498727-7498813,7498962-7498986, 7499044-7499266,7499770-7499947,7500039-7500152, 7500249-7500380,7500488-7500588,7500720-7500933 Length = 839 Score = 27.9 bits (59), Expect = 6.1 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 2/124 (1%) Frame = +3 Query: 117 RAVSLLTASPLTKNLISKAIIQSGNALSSRAFQRDPLQSAKALARSLGCEAEDVDEI-LE 293 RA L +ASPL+ IS + S + +A ++ PL++ + ++ E + D + +E Sbjct: 306 RAKILHSASPLSVVSISPSKKNSSDQKIRKAVRKQPLKATQPISTQPDKEESNKDGLFVE 365 Query: 294 FLIATPAKDLVEADEKLNSLQKVLETSNNLFGLVIEKEFPGVEAV-ISEPFINILTSGRT 470 + PAK +EK + VLE ++N F ++ E G + I I + R Sbjct: 366 PICTIPAK----KEEK--QIDIVLENTSN-FRKQMKLEHTGTNIMDIEHSSIQVTQGERY 418 Query: 471 ANIP 482 N P Sbjct: 419 MNTP 422 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,836,279 Number of Sequences: 37544 Number of extensions: 250372 Number of successful extensions: 717 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -