BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0790 (787 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016684-16|AAB66213.1| 506|Caenorhabditis elegans Hypothetical... 29 5.0 Z48055-7|CAO78722.1| 452|Caenorhabditis elegans Hypothetical pr... 28 8.7 >AF016684-16|AAB66213.1| 506|Caenorhabditis elegans Hypothetical protein F45C12.16 protein. Length = 506 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 618 TFISY*KISLHVSNSHSSFAKLFISQFRYVS-DLYKKNRLYVFCLNTDDIKRQKL 779 TFI K +++ N HS+F + F +++ D+Y KN +C + +Q L Sbjct: 293 TFIGSGKFIVNLENLHSNFCVTYQEMFIFMTQDVYFKNLHANYCEGKEQYVKQAL 347 >Z48055-7|CAO78722.1| 452|Caenorhabditis elegans Hypothetical protein T07A5.7 protein. Length = 452 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 678 KLFISQFRYVSDLYKKNR-LYVFCLNTDDIKRQKL 779 KLF F +++ LY+K+R Y+ N +K+ K+ Sbjct: 317 KLFFKPFSFLNHLYQKHRQAYITATNDKALKKSKI 351 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,068,176 Number of Sequences: 27780 Number of extensions: 302770 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -