BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0783 (658 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical pr... 28 5.1 U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical pr... 28 5.1 AF024494-12|AAB70332.3| 332|Caenorhabditis elegans Serpentine r... 27 8.9 >U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical protein F14B8.5a protein. Length = 537 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 374 HCNFGVSNGIL*CAYSFMRVLPCACSTQQY 285 +CNF SN C +SF+ V+ CA + QY Sbjct: 172 NCNFVPSNHQNQCQFSFVLVISCADQSIQY 201 >U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical protein F14B8.5b protein. Length = 501 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 374 HCNFGVSNGIL*CAYSFMRVLPCACSTQQY 285 +CNF SN C +SF+ V+ CA + QY Sbjct: 136 NCNFVPSNHQNQCQFSFVLVISCADQSIQY 165 >AF024494-12|AAB70332.3| 332|Caenorhabditis elegans Serpentine receptor, class u protein28 protein. Length = 332 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 100 AEGSLTCVVLCVICKYFIYLFIYIYACIHSIVLNFY 207 AE SLT + +IC Y I I A ++SI ++Y Sbjct: 252 AEVSLTVTTVSMICSYLSNSMIVIAAQLNSIEYSYY 287 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,363,417 Number of Sequences: 27780 Number of extensions: 217620 Number of successful extensions: 688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -