BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0778 (615 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 25 0.67 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.0 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 23 2.7 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 6.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 8.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 8.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 8.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 8.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 8.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 8.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 8.2 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.6 bits (51), Expect = 0.67 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 123 RVMGLTAEVFTRLLGSGVLEVVF 191 R++G T E+F L G ++ V+F Sbjct: 228 RILGDTVEIFNSLFGYQIILVIF 250 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ TS S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTE 180 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 22.6 bits (46), Expect = 2.7 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 378 MVLYSVKKC--YYNSVFLLSKRASNSC 304 +VL K C Y +F LSKRAS+ C Sbjct: 191 IVLDMGKNCVTYVFDLFYLSKRASDLC 217 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 170 WGARSGIRRATRTQTIPFHTNMSKLLRYRELGT 268 W A G + T +P T +S LR+ L T Sbjct: 244 WVASFGRPKMTPQSLLPSQTGLSPYLRFGCLST 276 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 101 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 136 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 168 SPIGA*TPPPLAPSLFLTSPYRGPRRSNT*ASPSTE 61 SP+ T PP P+ S S+T ++ STE Sbjct: 145 SPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTE 180 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,250 Number of Sequences: 336 Number of extensions: 3348 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -