BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0778 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0541 + 4275660-4275766,4275856-4275973,4276160-4276386,427... 29 2.9 01_01_1134 + 8994315-8995892 29 2.9 12_02_0513 - 19906147-19906271,19906470-19906791,19907091-199076... 28 5.1 07_03_1139 + 24254662-24255306 28 6.8 >11_01_0541 + 4275660-4275766,4275856-4275973,4276160-4276386, 4276505-4276729,4276902-4277052,4277139-4277345, 4277442-4277520,4277605-4277723 Length = 410 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 571 GHITLLSQISNQKVFTRHIL 512 G +TLLSQ+ +Q V T+H+L Sbjct: 176 GKVTLLSQLKSQGVITKHVL 195 >01_01_1134 + 8994315-8995892 Length = 525 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 186 PLRAPHSPIGA*TPPPLAPSLFLTSPYRG 100 P++ SP + PPPLA S+F +P RG Sbjct: 207 PVKMKISPGSSTFPPPLANSIFAAAPNRG 235 >12_02_0513 - 19906147-19906271,19906470-19906791,19907091-19907695, 19908569-19908617 Length = 366 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 333 KTPNYNNIFLRSIRPFIIGNQIQYDIIVIND 425 K+P N F+R + P +G I +D++ ND Sbjct: 185 KSPKAVNEFVRRVSPATVGRSIDWDLVRDND 215 >07_03_1139 + 24254662-24255306 Length = 214 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 116 PAHTVGPEGQIPRLHPRQRDDIPSP 42 PAH P +P L P RD PSP Sbjct: 152 PAHRPDPATAVPHLPPLGRDPSPSP 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,427,578 Number of Sequences: 37544 Number of extensions: 357557 Number of successful extensions: 1059 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -