BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0775 (752 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039053-3|AAC25880.2| 349|Caenorhabditis elegans Hypothetical ... 28 6.2 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 28 8.2 AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 8.2 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 8.2 >AF039053-3|AAC25880.2| 349|Caenorhabditis elegans Hypothetical protein C45H4.13 protein. Length = 349 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 642 FNRNNFSIRYWSWN-YRGCWHQNLPSNCSSLKYLK 541 +N N +S Y+ N YR CW Q+ + +S Y K Sbjct: 315 YNNNYYSGNYYCCNSYRSCWRQSYSCSGNSYYYGK 349 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 630 CCG*KARSCICAPRCRCTAFR 692 CCG C C PRC C R Sbjct: 79 CCGCGCGCCCCRPRCCCCCRR 99 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 445 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 341 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 80 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 184 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,037,079 Number of Sequences: 27780 Number of extensions: 358570 Number of successful extensions: 1027 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -