BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0769 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27409| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00046) 30 2.0 SB_45601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 29 4.7 >SB_27409| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00046) Length = 240 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +3 Query: 312 PRYCWISSDYLSNKVRCCYVGH*CQSTLLKYPLKATSQEFKRPRIPILNRSGFELLS 482 P Y W SS +L+ ++R C L YP T + P L+ ++ +S Sbjct: 91 PVYNWFSSPFLARRIRIVVQAPKCLQQRLPYPRLHTHDSISQTTYPRLHTHTYDSIS 147 >SB_45601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 14 SPRGWVQLETLELIAQGWWRIY 79 +PRG V LE LE I QGW+ Y Sbjct: 51 APRGSVPLERLEEIVQGWYDWY 72 >SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 62 GWWRIYVVDVYGLQ*PLNIR-WAVELTLHSTHISNKKNIVFL 184 GW++I ++ + Q PLNIR W ++ S+H ++ I L Sbjct: 1379 GWYKICLLSLQQEQQPLNIRSWCSQIPTSSSHSGSQVEIAEL 1420 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = -2 Query: 568 VPQFITKYTYACTHYRCDADSAPLVLIRFDNSSNPERFNIGMRGRLNSCDVALSGYFNKV 389 V FIT++ YR D + L + + RFN R LN+ D AL+ N Sbjct: 93 VNDFITRFQRMTEFYRWDDERKLRALPLYLTGNASVRFNSHPRAALNTWDAALTQLKNHF 152 Query: 388 D 386 D Sbjct: 153 D 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,295,362 Number of Sequences: 59808 Number of extensions: 465218 Number of successful extensions: 839 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -