BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0769 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 25 3.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 3.9 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 23 9.0 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 72 AFTLWMSMGSSNHLTSG 122 AFTL + +GSS H +SG Sbjct: 89 AFTLTVRLGSSRHASSG 105 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 107 PLNIRWAVELTLHSTHISNKKNIVFLMNSYPLHDKCGHNGG 229 P N+ TLH N + +++ S+ +H GH GG Sbjct: 909 PTNVIAVHSQTLHIPECPNGWDGLWIGYSFLMHTAVGHGGG 949 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 194 YPLHDKCGHNGGAATCGILIRNT 262 YP +D CG N TCG NT Sbjct: 30 YP-YDVCGPNEEFQTCGTACPNT 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,932 Number of Sequences: 2352 Number of extensions: 16106 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -