BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0769 (686 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119083-1|AAM50943.1| 516|Drosophila melanogaster LP10535p pro... 30 3.4 AY075521-1|AAL68329.1| 623|Drosophila melanogaster RE70153p pro... 30 3.4 AE014296-1994|AAF50035.2| 623|Drosophila melanogaster CG32091-P... 30 3.4 AY051784-1|AAK93208.1| 418|Drosophila melanogaster LD30467p pro... 29 7.9 AE014297-803|AAF54280.1| 418|Drosophila melanogaster CG9797-PA ... 29 7.9 >AY119083-1|AAM50943.1| 516|Drosophila melanogaster LP10535p protein. Length = 516 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 323 TISRFPRQVLILV*FHCVQWWYCVLRSRTWR 231 T+SR P QVL+ + F V +W L + WR Sbjct: 344 TVSRLPVQVLLNITFMAVTYWMSGLPQQFWR 374 >AY075521-1|AAL68329.1| 623|Drosophila melanogaster RE70153p protein. Length = 623 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 323 TISRFPRQVLILV*FHCVQWWYCVLRSRTWR 231 T+SR P QVL+ + F V +W L + WR Sbjct: 451 TVSRLPVQVLLNITFMAVTYWMSGLPQQFWR 481 >AE014296-1994|AAF50035.2| 623|Drosophila melanogaster CG32091-PB protein. Length = 623 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 323 TISRFPRQVLILV*FHCVQWWYCVLRSRTWR 231 T+SR P QVL+ + F V +W L + WR Sbjct: 451 TVSRLPVQVLLNITFMAVTYWMSGLPQQFWR 481 >AY051784-1|AAK93208.1| 418|Drosophila melanogaster LD30467p protein. Length = 418 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 212 CGHNGGAATCGILIRNTTIVHSGTR 286 CG G A T G +++N ++HSG R Sbjct: 337 CGTCGKAFTTGYILKNHMLIHSGER 361 >AE014297-803|AAF54280.1| 418|Drosophila melanogaster CG9797-PA protein. Length = 418 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 212 CGHNGGAATCGILIRNTTIVHSGTR 286 CG G A T G +++N ++HSG R Sbjct: 337 CGTCGKAFTTGYILKNHMLIHSGER 361 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,569,886 Number of Sequences: 53049 Number of extensions: 699136 Number of successful extensions: 1318 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1318 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -