BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0769 (686 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (d... 32 0.33 U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical pr... 29 3.1 >AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (divalent cation transporter)homolog protein 3 protein. Length = 666 Score = 32.3 bits (70), Expect = 0.33 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -2 Query: 175 YVFFVAYMSG---VECELHSPPDVKWLLEPIDIHNVNAP 68 Y+ F+AY++ V E SP KWL EPI H+ +AP Sbjct: 606 YIIFIAYLTYYCLVAMEFISPIQTKWLAEPI-YHDFDAP 643 >U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical protein F56C9.3 protein. Length = 446 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +2 Query: 35 LETLELIAQGWWRIYVVDVYGLQ*PLNIRWAVELTLHSTHISNKKNIVFLMNSY 196 + +++LI RI+ VYG++ P+N+ W + ST I+ K + + Y Sbjct: 216 MASVQLIISSVRRIHDAAVYGIKDPINVSWPTIAIMGST-IAVKLTLFIICQKY 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,468,684 Number of Sequences: 27780 Number of extensions: 350050 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -