BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0769 (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g11090.1 68415.m01187 expressed protein 28 5.0 At3g55950.1 68416.m06217 protein kinase family protein contains ... 28 6.7 At1g32160.1 68414.m03956 expressed protein 28 6.7 At3g18110.1 68416.m02303 pentatricopeptide (PPR) repeat-containi... 27 8.8 >At2g11090.1 68415.m01187 expressed protein Length = 151 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 238 VRDLNTQYHHCTQWN*TSIKT*RGNLDIVGSQAIT 342 V DL+T HH T W+ T+ T R + S IT Sbjct: 26 VEDLSTSRHHSTPWSSTTWTTTRSHYSTPWSSIIT 60 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 221 NGGAATCGILIRNTTIVHSGTRPVSKLDVET 313 +G +CG+ IRN I+ GT PV ++T Sbjct: 164 SGVGFSCGVSIRNNRILCWGTDPVKSNQIQT 194 >At1g32160.1 68414.m03956 expressed protein Length = 406 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 662 PNILVHIVSISYSPSFYCVNKNNDDKSV*SARSPIYY 552 P+ L+ I Y P Y + +N D+ S RS + Y Sbjct: 283 PDSLIRIQPEEYDPDEYAIQRNEDESSSYGLRSYVTY 319 >At3g18110.1 68416.m02303 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 1429 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 28 GTT*DLRTYSSRLVAHLRCGC 90 G T DL+T++S + A+ +CGC Sbjct: 782 GRTPDLKTWNSLMSAYAQCGC 802 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,548,819 Number of Sequences: 28952 Number of extensions: 328589 Number of successful extensions: 662 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -