BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0766 (616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 28 1.2 SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa... 26 3.8 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 27.9 bits (59), Expect = 1.2 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +1 Query: 253 YLKVFTFKFIGTNMYRNVV*FFNVCKEDVTSLHFFFIMLYTHFF*TFSPFLLLVKFQYTL 432 Y+ FTF IG ++ + +++ K +T FF L F F PFL + + Y Sbjct: 247 YVGFFTFLSIGLSVCLELWYLWDI-KTGLTVERFFQHFLARFFCLIFFPFLFFLFWFYMH 305 Query: 433 YNIL 444 +NIL Sbjct: 306 FNIL 309 >SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1049 Score = 26.2 bits (55), Expect = 3.8 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 191 ESVVFLFSIILRLQNYMRSQYI*KYSHSSLSELT 292 ES +F+++ + N RSQY+ SHSSL T Sbjct: 994 ESSHVMFTLLTKRGNKQRSQYLEIPSHSSLVRST 1027 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,340,006 Number of Sequences: 5004 Number of extensions: 47042 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -