BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0763 (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92796-2|CAB07231.1| 347|Caenorhabditis elegans Hypothetical pr... 30 2.0 Z48009-9|CAA88085.1| 329|Caenorhabditis elegans Hypothetical pr... 28 6.1 >Z92796-2|CAB07231.1| 347|Caenorhabditis elegans Hypothetical protein H25K10.3 protein. Length = 347 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 325 YCIHFPIYFCWKPVTCSSI 269 YC HF +YF W V C ++ Sbjct: 104 YCAHFYLYFAWTSVICQAM 122 >Z48009-9|CAA88085.1| 329|Caenorhabditis elegans Hypothetical protein AH6.12 protein. Length = 329 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 409 LCLSLITYM-KMMKVKFIKSSMIVSGHKQTRQTKLTFYN*FYSNIPQIVWFID 564 L S TYM ++ +K + I +T L F N FY+N+ QIV+ ID Sbjct: 28 LITSFFTYMLSIIAIKMVLKQSIF----ETSTKILLFLNIFYANLYQIVYSID 76 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,401,927 Number of Sequences: 27780 Number of extensions: 303193 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -