BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0758 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1028 + 30230224-30231274,30231500-30231609,30232144-302321... 30 1.9 02_01_0427 - 3124209-3124307,3124453-3125240,3125510-3125867,312... 30 1.9 06_01_0602 - 4342333-4342790,4342899-4345623 29 3.3 01_06_0363 - 28745581-28745709,28746043-28746114,28746373-287464... 29 3.3 03_05_0356 - 23421394-23421870 29 4.4 02_01_0429 - 3132848-3135043 28 7.7 02_01_0425 - 3102629-3104692,3106505-3108546,3109918-3109989,311... 28 7.7 >04_04_1028 + 30230224-30231274,30231500-30231609,30232144-30232170, 30233107-30234252 Length = 777 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -1 Query: 313 STSGSCSTAGKANASGSCNSGLELNKFIISLPGEASIKFNLSFGINIGSGTL*SAFDL 140 ST+GSC+T G+ N+ G C + + + L + F + +GT +AF L Sbjct: 182 STNGSCTTNGRVNSDGLCPGTACCDAYGMPLDDAQEVTFEFNKTSASVAGTCSAAFIL 239 >02_01_0427 - 3124209-3124307,3124453-3125240,3125510-3125867, 3125902-3126567 Length = 636 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 206 TCLSRQRNNELIEFKAGIAAPGGIRFSCRAARPRCT 313 +C + + NN L++F AG++ GG+ S R C+ Sbjct: 19 SCCTERENNCLLQFLAGLSQDGGLAASWRLGTDCCS 54 >06_01_0602 - 4342333-4342790,4342899-4345623 Length = 1060 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 358 F*FSKIVSNCDNDMTSTSGSCSTAGKANASGSCNS 254 F +K+V N D D+T+ SGS + A +S CNS Sbjct: 864 FGIAKLVKNADGDVTTNSGSIAAA----SSDPCNS 894 >01_06_0363 - 28745581-28745709,28746043-28746114,28746373-28746417, 28746523-28746618,28747029-28747080,28747232-28747305, 28747386-28747502,28747844-28747930,28748186-28748281, 28748508-28748654 Length = 304 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +3 Query: 63 GEVKPKKIEWPAFNFDDDPIKQLQTLKSNADYNV 164 G +K + ++ P+F+F+DD I Q L+S DYNV Sbjct: 25 GTLKAELLKDPSFDFNDDAI---QWLESMLDYNV 55 >03_05_0356 - 23421394-23421870 Length = 158 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 300 LAARQEKRMPPGAAIPALNSISS 232 +A ++ K+MPP AA PAL I+S Sbjct: 103 VARKETKKMPPAAASPALADIAS 125 >02_01_0429 - 3132848-3135043 Length = 731 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 203 DTCLSRQRNNELIEFKAGIAAPGGIRFSCRAARPRCT 313 D+C+ ++++ L++F AG++ GG+ S R CT Sbjct: 35 DSCIDQEKS-VLLQFLAGLSGDGGLSASWRNGTNCCT 70 >02_01_0425 - 3102629-3104692,3106505-3108546,3109918-3109989, 3110157-3111444 Length = 1821 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 203 DTCLSRQRNNELIEFKAGIAAPGGIRFSCRAARPRCT 313 D+C+ ++++ L++F AG++ GG+ S R CT Sbjct: 458 DSCIDQEKS-VLLQFLAGLSGDGGLSASWRNGTNCCT 493 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,254,568 Number of Sequences: 37544 Number of extensions: 319453 Number of successful extensions: 930 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -