BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0758 (670 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF006521-1|AAB62916.1| 122|Homo sapiens immunoglobulin heavy ch... 31 4.9 AK095945-1|BAC04658.1| 184|Homo sapiens protein ( Homo sapiens ... 30 8.6 >AF006521-1|AAB62916.1| 122|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 122 Score = 30.7 bits (66), Expect = 4.9 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 233 ELIEFKAGIAAPGG-IRFSCRAARPRCTRHIIITIR 337 +L+EF G+ PGG +R SC A +RH +I +R Sbjct: 3 QLVEFGGGLVQPGGSLRLSCDATGFIFSRHDMIWVR 38 >AK095945-1|BAC04658.1| 184|Homo sapiens protein ( Homo sapiens cDNA FLJ38626 fis, clone HEART2009599. ). Length = 184 Score = 29.9 bits (64), Expect = 8.6 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -2 Query: 315 RVHRGLAARQEKRMPPGAAIPALNSISSLFLCRERQVSN-LTYPSGSTSG 169 R RG R+ +R+P +P+L S SS L R R LT S + SG Sbjct: 12 RAARGRGGRRGQRLPGSPTLPSL-SFSSAILLRSRSPGRCLTITSAAVSG 60 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,149,293 Number of Sequences: 237096 Number of extensions: 1650452 Number of successful extensions: 3304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3304 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -