BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0758 (670 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023828-6|CAA19451.1| 371|Caenorhabditis elegans Hypothetical ... 28 5.2 AF022979-3|AAB69902.2| 198|Caenorhabditis elegans Hypothetical ... 27 9.1 >AL023828-6|CAA19451.1| 371|Caenorhabditis elegans Hypothetical protein Y17G7B.4 protein. Length = 371 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 434 NAMHRTVYHSST*PADESPKADTVDGCLSWGH*RRDLGCTQPHAVATL 577 N TVY ++ D S D +SWG + G + HA ATL Sbjct: 306 NGADHTVYINTGQEFDGSDSGAQPDEAVSWGKVKPSAGAVKVHAEATL 353 >AF022979-3|AAB69902.2| 198|Caenorhabditis elegans Hypothetical protein T02B11.4 protein. Length = 198 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 483 SHPKPIPSMDALAGDIDAATSGALNHMLWLPYLTQLEAVAN-CSQSLNFLKALN 641 S K IP+M+ +G AL L P++ Q + V N C + LN KA N Sbjct: 78 SMSKAIPAMNLYSGFNSCTDLMALIDKLMKPFMNQCKQVINKCLKVLNNCKANN 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,675,965 Number of Sequences: 27780 Number of extensions: 266294 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -