BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0756 (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q24262 Cluster: Blastopia polyprotein; n=2; Drosophila ... 43 0.008 UniRef50_Q4Y758 Cluster: Putative uncharacterized protein; n=1; ... 38 0.24 UniRef50_UPI0000F31553 Cluster: UPI0000F31553 related cluster; n... 33 6.7 >UniRef50_Q24262 Cluster: Blastopia polyprotein; n=2; Drosophila melanogaster|Rep: Blastopia polyprotein - Drosophila melanogaster (Fruit fly) Length = 1333 Score = 42.7 bits (96), Expect = 0.008 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -1 Query: 695 PYRIVKVKRKNRSNVEKADAQVEGPNKTTTSADFMKKW 582 PY + VK R +V+KA A VEGPN T+TS D MK W Sbjct: 1274 PYEVTGVKDNGRYDVKKA-ANVEGPNVTSTSCDNMKLW 1310 >UniRef50_Q4Y758 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 163 Score = 37.9 bits (84), Expect = 0.24 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -1 Query: 494 SYSSIMLHLLAYDVLISFYHKMSFVFFLS*FCCNMFSL*SYDVNVIVVNCF 342 S+ + L + AY+ + FY K SFV + F C FS+ ++++ +CF Sbjct: 19 SFYILYLFMYAYETICIFYKKTSFVLICATFICTYFSVAFVSYSLLIFSCF 69 >UniRef50_UPI0000F31553 Cluster: UPI0000F31553 related cluster; n=1; Bos taurus|Rep: UPI0000F31553 UniRef100 entry - Bos Taurus Length = 194 Score = 33.1 bits (72), Expect = 6.7 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 115 HPSVILSSHTSSPSILDIPLRSQTST--CIHHIMRSIKHHSHIRPSC 249 H +L +HTSSPS + PL + T T C H+ + + HH+H+ C Sbjct: 137 HSPCLLHTHTSSPS-MHTPLYTHTHTHQCTHNPL--VYHHTHLFHHC 180 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,020,319 Number of Sequences: 1657284 Number of extensions: 8362327 Number of successful extensions: 19538 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19534 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -