BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0755 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 26 4.4 SPAC3A11.06 |mvp1||sorting nexin Mvp1|Schizosaccharomyces pombe|... 26 4.4 SPBC1709.18 |tif452|SPBC409.01|translation initiation factor eIF... 25 7.7 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 26.2 bits (55), Expect = 4.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 66 YHHPAYFYREAVTRFGLKGGAAVVTILETLELMSQGG 176 + P+ F E V L GG AVV + TLE + Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPAC3A11.06 |mvp1||sorting nexin Mvp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 664 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 222 NTRWAVSSSNHLKKKIYSSHVIIMFVLEIIVTIDFTVSGFFIF 350 +T+ +S+S H ++ SS LE+ V ID SG+F + Sbjct: 259 STQPLLSNSRHSSFRLASSSTSFPASLEMNVDIDLEPSGYFFY 301 >SPBC1709.18 |tif452|SPBC409.01|translation initiation factor eIF4E 4F complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 25.4 bits (53), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 614 WTAWYRLPPSASLARSDRLAGVL 546 WT W+ PP+ L SD L ++ Sbjct: 70 WTLWFLKPPTQGLEWSDLLKEII 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,750,981 Number of Sequences: 5004 Number of extensions: 53272 Number of successful extensions: 135 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -