BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0755 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70683-2|CAA94592.2| 717|Caenorhabditis elegans Hypothetical pr... 30 1.8 AF016687-4|AAC48097.1| 183|Caenorhabditis elegans Hypothetical ... 27 9.4 >Z70683-2|CAA94592.2| 717|Caenorhabditis elegans Hypothetical protein F13B12.3 protein. Length = 717 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 352 IKIKNPDTV-KSIVTMISKTNIIMTWELYIFFFRWLDELTAHLVLRGYWSS 203 +KI N D SIV MI K IM +++F W H+ L G+ S Sbjct: 423 MKIANVDAFFGSIVLMIKKMIPIMVKFMFVFMVFWFTYAVCHISLAGHLKS 473 >AF016687-4|AAC48097.1| 183|Caenorhabditis elegans Hypothetical protein T21D12.12 protein. Length = 183 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 609 CMVQTTTECFSC*I*PSGWCSAHGALAFYSTRN 511 C Q T+CFS + C GA +FY +N Sbjct: 15 CFAQQQTDCFSARDTGNSGCGQQGARSFYFHKN 47 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,601,549 Number of Sequences: 27780 Number of extensions: 318568 Number of successful extensions: 780 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -