BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0755 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 0.51 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.6 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 6.2 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 25.4 bits (53), Expect = 0.51 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 551 VLPTARLPSIRPVIMSFSNSCLGDRMMCPKKLITHCLTT 435 VL P + ++FS SCL + ++CP +T TT Sbjct: 416 VLTIEEKPFVYVREIAFSESCLPEEILCPHFNVTDGETT 454 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 561 SGWCSAHGALAFYSTRNYELL*FMSGRPHDVSEEAHNTLLDYL 433 +GW G FY + Y+ ++ R DV EE N + +L Sbjct: 178 TGWTFHEGRKQFYFHQFYKQQPDLNYRNSDVREEMKNIMKFWL 220 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 625 HGWHGLHG 602 HG HGLHG Sbjct: 135 HGLHGLHG 142 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 625 HGWHGLHG 602 HG HGLHG Sbjct: 138 HGLHGLHG 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,747 Number of Sequences: 438 Number of extensions: 3938 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -