BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0755 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53460.1 68418.m06644 glutamate synthase [NADH], chloroplast,... 27 8.7 At4g10720.1 68417.m01752 ankyrin repeat family protein contains ... 27 8.7 >At5g53460.1 68418.m06644 glutamate synthase [NADH], chloroplast, putative similar to SP|Q03460 Glutamate synthase [NADH], chloroplast precursor (EC 1.4.1.14) (NADH- GOGAT) {Medicago sativa} Length = 2208 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 93 EAVTRFGLKGGAAVVTILETLELMSQGGWRIYVVDV 200 E R LKG + +E ++ M+ GWR V+D+ Sbjct: 681 EQCHRLSLKGPLLKIEEMEAIKKMNYRGWRTKVLDI 716 >At4g10720.1 68417.m01752 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 445 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -3 Query: 373 YINLA*AIKIKNPDTVKSIVTMISKTNIIMTWELYIFFFRW 251 Y++ ++ + +PDTV + T I++ + +FF RW Sbjct: 377 YVSYLVSMSVISPDTVWYVSTNAGSVIIVVFAYMVVFFLRW 417 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,745,506 Number of Sequences: 28952 Number of extensions: 296361 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -