BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0752 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.5 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 24 4.4 AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 23 7.7 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 505 QTETHYCFTPEIGGAVVPTRADSQXVLPPVKTPDTRT 615 + ++ Y P+ G P A +Q LPPV+ P+T T Sbjct: 1445 EAKSSYQQQPDSGTEQAPREATAQ--LPPVQPPETLT 1479 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 24.2 bits (50), Expect = 4.4 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 475 MYSYNGCPNLQTETHYCFTPEIGGAVVPTRADSQXVLPPVKTPDTRTLFP 624 +YS P L + HYC + I VV R+ ++TP R+ FP Sbjct: 57 VYSSYVLPKLYAKLHYCVSCAIHSKVVRNRSKETR---RIRTPPQRS-FP 102 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -1 Query: 665 PYKWERQNHIY*RNGNKVLVSGVFTGGRTSCESARV 558 PY+W+R N G S F G SC ++ Sbjct: 4 PYRWQRTNAAESSTGRTPSASLPFAIGARSCIGQKI 39 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,556 Number of Sequences: 2352 Number of extensions: 16116 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -