BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0749 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 29 0.70 SPAC1142.09 ||SPAC8C9.02|dubious|Schizosaccharomyces pombe|chr 1... 28 1.6 SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomy... 26 5.0 SPAC4D7.05 |sum1|tif34|translation initiation factor eIF3i|Schiz... 25 8.7 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 8.7 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 29.1 bits (62), Expect = 0.70 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -1 Query: 227 YHHPAYFSREAVMRFGLKGGAAVVTILETLELISQGG 117 + P+ F+ E V+ L GG AVV + TLE I Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPAC1142.09 ||SPAC8C9.02|dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 115 Score = 27.9 bits (59), Expect = 1.6 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 589 FIIKASGSSFSLKILTYCLCYFIYSLFYVTYILH 690 F++K + +S+S +++Y C FI SLF+ +H Sbjct: 68 FVLKTN-NSYSAILISYYRCIFIISLFHRPLTIH 100 >SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 167 PHPSNRNALLLHG*NRQGDGTYP 235 PHP N +LL G N Q D + P Sbjct: 97 PHPENSKIVLLMGSNAQNDPSSP 119 >SPAC4D7.05 |sum1|tif34|translation initiation factor eIF3i|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 25.4 bits (53), Expect = 8.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 445 NWGSTIVNLNTYTDSTYLLIS 507 N GSTI +L Y D TY + S Sbjct: 189 NSGSTITDLQFYPDRTYFITS 209 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 25.4 bits (53), Expect = 8.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 50 AHSPPGVKWLLEPIDIYNVNTATHLEI*VLRSQE*LQ 160 A PP +K P+DI N++ A L+ L +E LQ Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLKKIDLLLEEILQ 260 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,833,486 Number of Sequences: 5004 Number of extensions: 55763 Number of successful extensions: 116 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -