BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0743 (786 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 25 1.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.4 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.8 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 24.6 bits (51), Expect = 1.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 49 KYYKNLGCLIKNAKRKKHLVEHEQ 120 KY N C I A K H++++++ Sbjct: 70 KYLTNYSCFITCALEKSHIIQNDE 93 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 729 YAGTSEQRRVWCKLLYFENER 667 Y ++ RVW L+F NE+ Sbjct: 106 YLTLTDASRVWMPDLFFSNEK 126 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 729 YAGTSEQRRVWCKLLYFENER 667 Y ++ RVW L+F NE+ Sbjct: 106 YLTLTDASRVWMPDLFFSNEK 126 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.8 Identities = 24/109 (22%), Positives = 44/109 (40%), Gaps = 5/109 (4%) Frame = +1 Query: 319 IVNDQEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIR-----IVEPSYVGM 483 + N + + ++ +L P N Y +A++ L E + V+ IVEP+ V + Sbjct: 660 VTNMDQYNSILMIEHLSPDH-NGNYSCVARN-LAAEVSHTQRLVVHVPPRWIVEPTDVSV 717 Query: 484 NNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYIGT 630 ++L + G P I + +S + E Y I+ GT Sbjct: 718 ERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGT 766 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 232,621 Number of Sequences: 438 Number of extensions: 5241 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -