BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0741 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 5.3 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 7.0 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 5.3 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -1 Query: 493 QTETHYCFTAEIGGVVVPTRADSQEVIPP-IKTSIFDNKYFELLYQNNVVKPRSSFLKR 320 Q ET C+T+ ++ QEV P +K + +KY+ Y+ N+ + + L R Sbjct: 1179 QNETLSCYTSRRNSTTSNANSEPQEVAPQFVKFARDSSKYW---YKPNISREEAIALLR 1234 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.4 bits (48), Expect = 7.0 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 6/74 (8%) Frame = -2 Query: 621 RDHSPPGVKWLLEPI--DIYNLNAPPAVDI----SSKVSSIVTTAAPPFKPKRITASRQK 460 R+ S P W ++ DI+ + AVD S + I+ TA KR + K Sbjct: 213 RNLSRPITGWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTACNATMTKRKRYTPNK 272 Query: 459 *AGWWYLPVRTHKR 418 A WW L + ++ Sbjct: 273 SAFWWTLEIEALRK 286 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,822 Number of Sequences: 2352 Number of extensions: 12971 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -