BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0739 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69646-4|CAD36489.1| 611|Caenorhabditis elegans Hypothetical pr... 28 6.9 Z69646-3|CAA93476.2| 630|Caenorhabditis elegans Hypothetical pr... 28 6.9 AF497829-1|AAM18107.1| 611|Caenorhabditis elegans putative Na-H... 28 6.9 AF497828-1|AAM18106.1| 630|Caenorhabditis elegans putative Na-H... 28 6.9 >Z69646-4|CAD36489.1| 611|Caenorhabditis elegans Hypothetical protein F57C7.2b protein. Length = 611 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 107 FSLHNYYFKNLSVSLPFF*LICFILSQYILCYIIQDYQ*LRNN--FFIFLVFRIIS 268 ++ +N ++ S + FF ++ FI+ +I CYI N F FL+F +IS Sbjct: 368 YTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLIS 423 >Z69646-3|CAA93476.2| 630|Caenorhabditis elegans Hypothetical protein F57C7.2a protein. Length = 630 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 107 FSLHNYYFKNLSVSLPFF*LICFILSQYILCYIIQDYQ*LRNN--FFIFLVFRIIS 268 ++ +N ++ S + FF ++ FI+ +I CYI N F FL+F +IS Sbjct: 368 YTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLIS 423 >AF497829-1|AAM18107.1| 611|Caenorhabditis elegans putative Na-H exchanger isoform 5b protein. Length = 611 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 107 FSLHNYYFKNLSVSLPFF*LICFILSQYILCYIIQDYQ*LRNN--FFIFLVFRIIS 268 ++ +N ++ S + FF ++ FI+ +I CYI N F FL+F +IS Sbjct: 368 YTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLIS 423 >AF497828-1|AAM18106.1| 630|Caenorhabditis elegans putative Na-H exchanger isoform 5a protein. Length = 630 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 107 FSLHNYYFKNLSVSLPFF*LICFILSQYILCYIIQDYQ*LRNN--FFIFLVFRIIS 268 ++ +N ++ S + FF ++ FI+ +I CYI N F FL+F +IS Sbjct: 368 YTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLIS 423 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,036,235 Number of Sequences: 27780 Number of extensions: 232975 Number of successful extensions: 392 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -