BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0739 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.6 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +2 Query: 251 VFRIISRYDINMYRYFKKM*ES---LKCRKLDMLFQL*YQGYCFFG 379 +F +I +N+ Y K+ E ++CR+L F G C FG Sbjct: 147 MFYLIIECSLNLETYLDKLIEKNEPIECRELTARFTTDVIGSCAFG 192 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 571 MCFSMKFHNK 542 MCFS+KF NK Sbjct: 544 MCFSLKFKNK 553 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,201 Number of Sequences: 438 Number of extensions: 2989 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -