BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-0739
(673 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.1
AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.6
>DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450
monooxygenase protein.
Length = 499
Score = 24.2 bits (50), Expect = 1.1
Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 3/46 (6%)
Frame = +2
Query: 251 VFRIISRYDINMYRYFKKM*ES---LKCRKLDMLFQL*YQGYCFFG 379
+F +I +N+ Y K+ E ++CR+L F G C FG
Sbjct: 147 MFYLIIECSLNLETYLDKLIEKNEPIECRELTARFTTDVIGSCAFG 192
>AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A
isoform protein.
Length = 567
Score = 23.0 bits (47), Expect = 2.6
Identities = 8/10 (80%), Positives = 9/10 (90%)
Frame = -1
Query: 571 MCFSMKFHNK 542
MCFS+KF NK
Sbjct: 544 MCFSLKFKNK 553
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,201
Number of Sequences: 438
Number of extensions: 2989
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20343105
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -