BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0738 (773 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF103479-1|AAD19479.1| 106|Homo sapiens immunoglobulin kappa li... 30 8.0 >AF103479-1|AAD19479.1| 106|Homo sapiens immunoglobulin kappa light chain variable region protein. Length = 106 Score = 30.3 bits (65), Expect = 8.0 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 171 FWGQNKGLPHTLTFEVVCIIPLSSAAHFCKESYASRF 61 F G G TLT + + P A +FC+ESY++RF Sbjct: 55 FSGSGSGTDFTLT--ISSLQPEDFATYFCQESYSTRF 89 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,305,845 Number of Sequences: 237096 Number of extensions: 1927303 Number of successful extensions: 2924 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2924 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9367263024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -