BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0738 (773 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78065-1|CAD54154.1| 547|Caenorhabditis elegans Hypothetical pr... 33 0.30 U55369-4|AAM29662.1| 1022|Caenorhabditis elegans Hypothetical pr... 29 4.9 AL110477-12|CAB54335.1| 348|Caenorhabditis elegans Hypothetical... 29 4.9 >Z78065-1|CAD54154.1| 547|Caenorhabditis elegans Hypothetical protein T09E8.1d protein. Length = 547 Score = 32.7 bits (71), Expect = 0.30 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query: 79 FFAEMSSR--GQGNDTNDLKG*CMRQSFVLPPELKIIDSLHQLVETMSRSTNRSSPIKSP 252 F+ +M R G G+ T+D G LPP + + S H +ET+S S+ + SP Sbjct: 13 FYTKMIERLTGGGSPTSDQNGNSHHHHHHLPPAPRHLSSSHHQIETISGSSKLRAQSGSP 72 Query: 253 KLS 261 L+ Sbjct: 73 ALN 75 >U55369-4|AAM29662.1| 1022|Caenorhabditis elegans Hypothetical protein C18C4.5a protein. Length = 1022 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 175 KIIDSLHQLVETMSRSTNRSSPIKSPKLSLDTILN 279 K +D L VET R S+PI P+ + TI N Sbjct: 944 KQVDELQSQVETAERKLKSSTPIAPPRSNTRTISN 978 >AL110477-12|CAB54335.1| 348|Caenorhabditis elegans Hypothetical protein Y113G7B.17 protein. Length = 348 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/78 (24%), Positives = 29/78 (37%) Frame = +3 Query: 297 NYANSMESEVVKYLIEFRQECFYGAFFFKDCKCTYI*IFCKVFSSVFVSIHNKTYFLRSN 476 N N + +V Y ++ F F + + YI F F+ F H KT F Sbjct: 223 NTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQAFVTFFTVEFSKCHKKTGFSTGP 282 Query: 477 NLXXXXXXXXXXYIKDYL 530 ++ Y+KD L Sbjct: 283 DVQYTHWKQTVFYLKDAL 300 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,336,722 Number of Sequences: 27780 Number of extensions: 329894 Number of successful extensions: 758 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -