BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0737 (795 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0234 + 15187065-15188241,15188316-15188494 40 0.002 04_03_0649 - 18402976-18403220,18403305-18404499 37 0.021 01_01_1102 - 8734984-8736090,8736430-8736557,8736671-8736708,873... 35 0.065 08_02_1201 - 25243516-25243681,25243784-25243892,25244046-252441... 31 0.80 02_03_0020 - 13996688-13996785,13997168-13997217,13997516-139976... 31 1.1 10_07_0101 - 12872296-12873288 30 1.8 12_02_0749 - 22758317-22760407 29 3.2 06_03_0260 - 18857970-18858737,18858909-18859145 29 3.2 03_01_0606 - 4461646-4462623 29 3.2 09_04_0362 - 16953108-16953155,16953478-16953562,16953626-169537... 29 4.3 07_01_0454 + 3443871-3444024,3444268-3444356,3445482-3445557,344... 29 4.3 07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-57... 29 4.3 03_02_0300 - 7246312-7246662,7246757-7246831,7246920-7246993,724... 29 4.3 06_03_0095 - 16575938-16576585,16577028-16577219,16577294-165773... 29 5.6 10_01_0273 - 2891910-2893459,2893554-2893665 28 7.4 01_06_0864 - 32546696-32546803,32546881-32546961,32547134-325472... 28 7.4 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 17 EICEFLREDNTTLVWDNEQMVPFAYRGDQWVGFDDERSLKTKMAWLKEEGFGGIMVWSVD 196 EI E+L+ + + DN+ + + Y GD WV FD ++ K+ ++ + G + ++ Sbjct: 322 EIEEYLKSQSVFVTHDNQSVADYFYSGDLWVSFDSAVVVQEKVEFVAKSQLLGYFLSTIS 381 Query: 197 MDD 205 DD Sbjct: 382 FDD 384 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +2 Query: 59 WDNEQMVPFAYRGDQWVGFDDERSLKTKMAWLKEEGFGGIMVWSVDMDD 205 +DN + + GD WV FD + K+A+ G G +W V+ DD Sbjct: 342 YDNASVASYVSVGDVWVAFDGVAVVAEKLAFAARCGLLGYFLWPVNYDD 390 >01_01_1102 - 8734984-8736090,8736430-8736557,8736671-8736708, 8736815-8737030,8737252-8737413,8738381-8738559, 8738693-8738799,8738918-8739082,8739201-8739284, 8739364-8739559 Length = 793 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 228 PVPQEPRKSSMSTDQTMIPPNPSSFSQAIFVLSDLSSSNPTHWSPR*ANGTICS 67 PVP R SS+ + M+P N + + +S ++ +W+P +GT CS Sbjct: 537 PVPPRRRPSSVYAESVMVPVNAAPWQSECSSECSMSLTSDMNWTPSIRDGTECS 590 >08_02_1201 - 25243516-25243681,25243784-25243892,25244046-25244148, 25244273-25244304,25244405-25244625,25244948-25245063, 25245149-25245404,25245916-25246003,25246133-25246210, 25246541-25246659,25246893-25246942,25247117-25247245 Length = 488 Score = 31.5 bits (68), Expect = 0.80 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +2 Query: 65 NEQMVPFA--YRGDQWVGFDDERSLKTKMAWLKEEGFGGIMVWSVDMDDFRGSCG-TGKF 235 N +P A + D + F + T++A + G W+ MDDF G TG+F Sbjct: 403 NNSTIPIAEALKDDNRISFHYQHLRFTQLAIKEGVKVKGYFTWTF-MDDFEWGDGYTGRF 461 Query: 236 PLITTMKQELSDYKVKLEY 292 LI ++ L Y+ K Y Sbjct: 462 GLIYVDRETLKRYRKKSSY 480 >02_03_0020 - 13996688-13996785,13997168-13997217,13997516-13997619, 13997664-13997764,13998436-13998505,13998604-13999422, 14000894-14001052 Length = 466 Score = 31.1 bits (67), Expect = 1.1 Identities = 40/156 (25%), Positives = 64/156 (41%), Gaps = 1/156 (0%) Frame = +2 Query: 71 QMVPFAYRGDQWVGFDDE-RSLKTKMAWLKEEGFGGIMVWSVDMDDFRGSCGTGKFPLIT 247 Q +PF +RGD + + + + TK A K E + +M S F S L Sbjct: 172 QEIPFRFRGDLYEDYGNTLNNSSTKEAHPKHEAYKEVMFVS----SFISS--EPIVHLHE 225 Query: 248 TMKQELSDYKVKLEYDGPYETVLTSGQYTTKDPTEVTCEEEDGHISYHKDQADCTMYYMC 427 T + K K GP+ VL Q TT+ + + E+E+ + D+ + + Sbjct: 226 TERPSSPLIKPKPCLSGPHNIVLVYHQETTRFLHDASLEKENLQAT---DKLETSTL--- 279 Query: 428 EGERKHHMPCPSNLVFNPNENVCDWPENVEGCAHHT 535 E ERKH + F ++ C E+ E C+ T Sbjct: 280 EDERKHSTYEHESFSFKIPQDSCSQKESPESCSIST 315 >10_07_0101 - 12872296-12873288 Length = 330 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 211 RLLWNWQVPAHHDHEAGTVRLQG 279 RL+W PAHHD A V +QG Sbjct: 223 RLIWRALGPAHHDSRASVVAVQG 245 >12_02_0749 - 22758317-22760407 Length = 696 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -1 Query: 243 MSGNLPVPQEPRKSSMSTDQTMIPPNPSSFSQAIFVLSD 127 +SG P+ P +SS+ST PP+P+ ++A +L++ Sbjct: 20 LSGANRRPETPPRSSLSTKSAANPPDPADPARAASILAE 58 >06_03_0260 - 18857970-18858737,18858909-18859145 Length = 334 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 283 LDLVVGQFLLHGRDERELASSTGAAEV 203 LD+++G F HG DER+L + +GA V Sbjct: 176 LDVLLGVFREHGLDERDLTALSGAHTV 202 >03_01_0606 - 4461646-4462623 Length = 325 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 561 AYRLAGGACVWCAHPSTFSGQSQTFSLGLNT 469 AY GG+C+W ST + + T+S +T Sbjct: 209 AYTAVGGSCIWMTVQSTVAAAAGTYSFDTST 239 >09_04_0362 - 16953108-16953155,16953478-16953562,16953626-16953702, 16954601-16954641,16955140-16955644,16955897-16956316 Length = 391 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -1 Query: 525 AHPSTFSGQSQTFSLGLNTRLEGHGMWCFRSPSHM*YMVQSAWSLW 388 A S+F G S S+ + +L+ HG WC S+ Y + +A W Sbjct: 313 ASGSSFGGTSLLGSMHRDGQLQHHGDWCGIDASYSRYHLTNARCAW 358 >07_01_0454 + 3443871-3444024,3444268-3444356,3445482-3445557, 3445875-3445880,3445984-3446131,3446237-3446394, 3446473-3446676,3446803-3447038,3447227-3447439, 3447984-3448082,3448262-3448371,3448581-3448655, 3449407-3449485,3449563-3449709,3449785-3449865, 3449975-3450094,3450580-3450702,3451382-3451459, 3451586-3451674,3451760-3451868,3452117-3452227, 3452557-3452612,3452697-3452874,3452971-3453072, 3453160-3453231,3453350-3453415,3453502-3453567, 3453676-3453759,3454638-3454754,3455753-3455827, 3455912-3455995,3456138-3456179 Length = 1148 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 98 DQWVGFDDERSLKTKMAWLKEEGFGG 175 DQW FDDER K EE +GG Sbjct: 521 DQWFKFDDERVTKEDAKRALEEQYGG 546 >07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-571542, 571635-571885,572018-572128,572209-572320,572626-572716, 573168-573507,573678-573900,573946-574204,574274-574481, 574572-574622,574712-574870,574956-575120,575322-575399, 575732-576031,576107-576259,576871-576918,577019-577188, 577738-577852,578462-578623,578789-578893,578969-579199, 579277-579410,579484-579738,579822-580110,580214-580306, 580395-580520,580646-580897 Length = 1693 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 766 LKILLLCTKCVIQVNQLLKTHPRTHTYLHSFIYRALTGTN 647 L ++ C KC+ +++ PR YL + Y+ L+G+N Sbjct: 1099 LTVVHACIKCLCALSKAADRGPRLLEYLVNIFYKHLSGSN 1138 >03_02_0300 - 7246312-7246662,7246757-7246831,7246920-7246993, 7247247-7247334,7247464-7247615,7247702-7247861, 7247940-7248095,7248181-7248396,7248808-7249065, 7249816-7250019,7251334-7251423 Length = 607 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 50 TLVWDNEQMVPFAYRGDQWVGFDDERSLK 136 T W++E+ VPF Y G + V +E+ L+ Sbjct: 451 TFAWEDERSVPFLYDGARLVAILEEQKLR 479 >06_03_0095 - 16575938-16576585,16577028-16577219,16577294-16577392, 16577496-16577618,16577717-16577929,16578143-16578251, 16578339-16578427,16578604-16578880,16578974-16579084, 16579160-16580508,16581218-16581631 Length = 1207 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 250 GRDERELASSTGAAEVVHVDRPDHDPAEPFFLQP 149 G D +TG + VV+V+ PD E F QP Sbjct: 31 GEDHSSRIGTTGFSRVVYVNEPDRHEEEGFRYQP 64 >10_01_0273 - 2891910-2893459,2893554-2893665 Length = 553 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +1 Query: 148 LAEGRRVR--RDHGLVCRHG-RLPRLLWNWQVPAH 243 L E RR+R RD GLV R G +P +W W VP H Sbjct: 411 LVEARRLRVARDAGLVNRPGATVPMGVW-WLVPQH 444 >01_06_0864 - 32546696-32546803,32546881-32546961,32547134-32547250, 32548264-32548338,32548618-32548680,32549122-32549187, 32549254-32549325,32549403-32549504,32549588-32549765, 32549871-32549926,32551578-32551688,32551797-32551865, 32551960-32552068,32552176-32552327,32552398-32552475, 32554257-32554379,32555527-32555646,32555729-32555809, 32555881-32556027,32556112-32556190,32557223-32557297, 32558004-32558113,32558984-32559082,32559700-32559815, 32559914-32560022,32560098-32560229,32560389-32560591, 32561428-32561585,32561668-32561797,32562529-32562607, 32562806-32562829 Length = 1073 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 98 DQWVGFDDERSLKTKMAWLKEEGFGG 175 D W FDDER K M EE +GG Sbjct: 410 DIWYKFDDERVTKEDMKRALEEQYGG 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,078,078 Number of Sequences: 37544 Number of extensions: 423830 Number of successful extensions: 1314 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1314 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -