BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0734 (436 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.7 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 265 NVFILENHSTYSGYVSISNPFNSHLMFTVITECFLSRPK 149 N +L + ST Y+ +SN N++L+ S+PK Sbjct: 6 NKLLLLDSSTQPNYLILSNKNNTYLVLNKYLLVKHSKPK 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 6.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 164 SVTTEINYAFAII 126 S+ T INY FA++ Sbjct: 2348 SLCTHINYGFAVL 2360 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 20.6 bits (41), Expect = 6.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 124 FIIANA*FISVVTENT 171 F++AN F+++VT T Sbjct: 400 FLVANLAFVTIVTYET 415 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,477 Number of Sequences: 336 Number of extensions: 2073 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9670396 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -