BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0734 (436 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 0.88 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 0.88 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 0.88 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 4.7 AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding pr... 23 4.7 AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 23 4.7 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 6.2 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.4 bits (53), Expect = 0.88 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ F L + S +SIS + H+ F ++ E Sbjct: 251 IIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVE 294 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.4 bits (53), Expect = 0.88 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ F L + S +SIS + H+ F ++ E Sbjct: 251 IIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVE 294 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 25.4 bits (53), Expect = 0.88 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 Query: 394 TNLNMLRCLETSNLFE*RHATIESKAKNKLSMVPCRASS 278 T L +CL NL + H T E KA N+ VPC S Sbjct: 26 TKLPYEKCL--INLGKGEHLTEEFKAINRFQKVPCITDS 62 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.0 bits (47), Expect = 4.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ VF L + S +SIS + + F ++ E Sbjct: 247 IIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAE 290 >AY146757-1|AAO12072.1| 246|Anopheles gambiae odorant-binding protein AgamOBP39 protein. Length = 246 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 171 SVFCHDRNKLCVCNYKGITVCYWE 100 SV+ D++ +C+ GI V +W+ Sbjct: 61 SVYPTDQDTMCMVRCAGIMVGFWD 84 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -2 Query: 171 SVFCHDRNKLCVCNYKGITVCYWE 100 SV+ D++ +C+ GI V +W+ Sbjct: 61 SVYPTDQDTMCMVRCAGIMVGFWD 84 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.6 bits (46), Expect = 6.2 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -2 Query: 216 YPTHSILI*CSRLLPSVFCHDRNKLCVCNYKGITVC 109 YP S+L ++ FC + N+ C+ + + C Sbjct: 477 YPPFSLLTQPEKIRDDTFCDEDNRPDSCSDRQLCTC 512 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 438,033 Number of Sequences: 2352 Number of extensions: 8204 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -